RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781080|ref|YP_003065493.1| hypothetical protein CLIBASIA_04910 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >gnl|CDD|33545 COG3750, COG3750, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 85 Score = 78.0 bits (192), Expect = 6e-16 Identities = 45/80 (56%), Positives = 59/80 (73%) Query: 3 DNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKKDE 62 Q V QLR FIER+ERLEEEKK + ++IKD+Y EAK GFDVKA++ I+ LRK D+ Sbjct: 6 STSQTVAAGQLRAFIERIERLEEEKKTIADDIKDVYAEAKGHGFDVKAVRTIIRLRKLDK 65 Query: 63 KQWMEEEQILDVYLRALGML 82 + EE+ ILD+Y+ ALGM+ Sbjct: 66 AERQEEDAILDLYMDALGMI 85 >gnl|CDD|39661 KOG4460, KOG4460, KOG4460, Nuclear pore complex, Nup88/rNup84 component [Nuclear structure, Intracellular trafficking, secretion, and vesicular transport]. Length = 741 Score = 26.6 bits (58), Expect = 1.4 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 15/90 (16%) Query: 2 IDNIQNVTQDQLRTFIERLERLEEEKKLLTEN---IKDIYGEAKATGFD-VKAIKKILSL 57 + + + + QL + L EE+K L E + D Y EAK D + +KK+L Sbjct: 590 VKLLCDQKKKQL----QDLSYCREERKSLREMAERLADRYEEAKEKQEDLMNRMKKLLHS 645 Query: 58 RKKD-------EKQWMEEEQILDVYLRALG 80 + E+ + +E Q++ LR LG Sbjct: 646 FHSELPVLSDAERDFKKELQLIPDQLRHLG 675 >gnl|CDD|37356 KOG2145, KOG2145, KOG2145, Cytoplasmic tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 397 Score = 26.4 bits (58), Expect = 1.8 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Query: 22 RLEEEKKLLTENIKDIYGEAKATGFDVK 49 LE+ KK EN KDI A GFD K Sbjct: 137 TLEDAKKYARENAKDII----AVGFDPK 160 >gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase. The N-terminal domain of the MaoC dehydratase, a monoamine oxidase regulatory protein. Orthologs of MaoC include PaaZ (Escherichia coli) and PaaN (Pseudomonas putida), which are putative ring-opening enzymes of the aerobic phenylacetic acid (PA) catabolic pathway. The C-terminal domain of MaoC has sequence similarity to enoyl-CoA hydratase. Also included in this CD is a novel Burkholderia xenovorans LB400 ALDH of the aerobic benzoate oxidation (box) pathway. This pathway involves first the synthesis of a CoA thio-esterified aromatic acid, with subsequent dihydroxylation and cleavage steps, yielding the CoA thio-esterified aliphatic aldehyde, 3,4-dehydroadipyl-CoA semialdehyde, which is further converted into its corresponding CoA acid by the Burkholderia LB400 ALDH. Length = 513 Score = 25.7 bits (57), Expect = 3.0 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 13 LR--TFIERLERLEEEKKLLTENIKDIYGEAKATG 45 LR TF ER L+ K L E +D+Y + ATG Sbjct: 53 LRALTFHERAAMLKALAKYLMERKEDLYALSAATG 87 >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt sensitivity, memory consolidation, and cardiac repolarization. A common SGK1 variant is associated with increased blood pressure and body weight. SGK1 may also contribute to tumor growth, neurodegeneration, fibrosing disease, and ischemia. Length = 325 Score = 25.4 bits (55), Expect = 3.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 46 FDVKAIKKILSLRKKDEKQWMEEEQIL 72 + VK ++K L+KK+EK M E +L Sbjct: 23 YAVKVLQKKAILKKKEEKHIMSERNVL 49 >gnl|CDD|34572 COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion]. Length = 309 Score = 24.8 bits (54), Expect = 5.2 Identities = 9/43 (20%), Positives = 22/43 (51%) Query: 4 NIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGF 46 +IQ+ L ++ L R+ E+K + ++ + EA+ + + Sbjct: 211 SIQSRHGGNLSELLDNLSRVIRERKKMKAKVRALSAEARMSAW 253 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.135 0.357 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,010,454 Number of extensions: 45988 Number of successful extensions: 308 Number of sequences better than 10.0: 1 Number of HSP's gapped: 306 Number of HSP's successfully gapped: 78 Length of query: 85 Length of database: 6,263,737 Length adjustment: 54 Effective length of query: 31 Effective length of database: 5,096,851 Effective search space: 158002381 Effective search space used: 158002381 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.6 bits)