RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781080|ref|YP_003065493.1| hypothetical protein CLIBASIA_04910 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 30.1 bits (68), Expect = 0.11 Identities = 5/33 (15%), Positives = 15/33 (45%), Gaps = 12/33 (36%) Query: 50 AIKKILSLRKKDEKQWMEEEQILD-VYLRALGM 81 ++ ++S+ E +++ V+ R + M Sbjct: 1 SLADVMSI-----------ESLVEVVFYRGMTM 22 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 28.7 bits (64), Expect = 0.28 Identities = 12/39 (30%), Positives = 17/39 (43%), Gaps = 9/39 (23%) Query: 47 DVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGMLKDE 85 ++K K+ L R+ K W+E E L LK E Sbjct: 25 NMKYRKRQLVTREAQIKDWVENE---------LEALKLE 54 Score = 24.1 bits (52), Expect = 6.8 Identities = 9/40 (22%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 5 IQNVTQDQLRTFIERLERL--EEEKKLLTENIKDIYGEAK 42 I++ +++L E + E++ + L E ++I+ EA+ Sbjct: 40 IKDWVENELEALKLEAEEIPSEDQNEFLLERTREIHNEAE 79 >3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} (A:) Length = 261 Score = 25.0 bits (53), Expect = 3.7 Identities = 8/41 (19%), Positives = 12/41 (29%), Gaps = 4/41 (9%) Query: 11 DQLRTFIERLERLEEEKKLLTENIKDIYG----EAKATGFD 47 + IE EE +K+ EN + A Sbjct: 219 AEAAVKIEEAVGREEXEKVARENARKFLRVLEAAALEHHHH 259 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.135 0.357 Gapped Lambda K H 0.267 0.0504 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 651,728 Number of extensions: 26743 Number of successful extensions: 204 Number of sequences better than 10.0: 1 Number of HSP's gapped: 202 Number of HSP's successfully gapped: 54 Length of query: 85 Length of database: 4,956,049 Length adjustment: 48 Effective length of query: 37 Effective length of database: 3,333,409 Effective search space: 123336133 Effective search space used: 123336133 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.6 bits)