BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781080|ref|YP_003065493.1| hypothetical protein CLIBASIA_04910 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781080|ref|YP_003065493.1| hypothetical protein CLIBASIA_04910 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 166 bits (420), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKK 60 MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKK Sbjct: 1 MIDNIQNVTQDQLRTFIERLERLEEEKKLLTENIKDIYGEAKATGFDVKAIKKILSLRKK 60 Query: 61 DEKQWMEEEQILDVYLRALGMLKDE 85 DEKQWMEEEQILDVYLRALGMLKDE Sbjct: 61 DEKQWMEEEQILDVYLRALGMLKDE 85 >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 24.6 bits (52), Expect = 0.28, Method: Compositional matrix adjust. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 15/66 (22%) Query: 35 KDIYGEAKATGFDVK------AIKKILSLRKKDEKQWMEEE---------QILDVYLRAL 79 +IY A+ G ++ IK IL+LR K + W +EE Q+++ L A Sbjct: 50 HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109 Query: 80 GMLKDE 85 L DE Sbjct: 110 RELNDE 115 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 22.7 bits (47), Expect = 1.2, Method: Compositional matrix adjust. Identities = 6/17 (35%), Positives = 12/17 (70%) Query: 65 WMEEEQILDVYLRALGM 81 + E E+++D + R +GM Sbjct: 476 YFESEEVMDYFTRCVGM 492 >gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 21.6 bits (44), Expect = 2.4, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 20 LERLEEEKKLLTENIKDIYGEA 41 +ER EE+KK+L E+ + + E Sbjct: 331 IERTEEQKKILEESAQFVRPEG 352 >gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] Length = 93 Score = 21.6 bits (44), Expect = 2.8, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 8 VTQDQLRTFIERLERLEEEKKLLTENIK 35 +T D+L +R + L K LL +N+K Sbjct: 29 ITSDELSDLTQRYDYLLLNKHLLVDNLK 56 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 25 EEKKLLTENIKDIYGEA-KATGFDVKAIKKILSLRKKDEKQWMEEEQILDVYLRALGML 82 E++KL N + GE + D+ A+K I +K + W + + D + ML Sbjct: 916 EKEKLEKRNFGNTLGEHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLML 974 >gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 8/13 (61%), Positives = 12/13 (92%) Query: 51 IKKILSLRKKDEK 63 +KKI +L+KKD+K Sbjct: 454 VKKITALQKKDKK 466 >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 20.4 bits (41), Expect = 5.3, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 19/28 (67%) Query: 58 RKKDEKQWMEEEQILDVYLRALGMLKDE 85 ++K+++ +EEQ+ + R LG+ +D+ Sbjct: 15 KQKNDQPKNKEEQLFFSFPRCLGISRDD 42 >gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 20.4 bits (41), Expect = 5.5, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 19/27 (70%) Query: 2 IDNIQNVTQDQLRTFIERLERLEEEKK 28 I++I+ + + + + +ERLERL E+ K Sbjct: 123 INDIETIETELMLSDLERLERLFEKNK 149 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.135 0.357 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,955 Number of Sequences: 1233 Number of extensions: 1931 Number of successful extensions: 14 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 85 length of database: 328,796 effective HSP length: 54 effective length of query: 31 effective length of database: 262,214 effective search space: 8128634 effective search space used: 8128634 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)