BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] gi|254040758|gb|ACT57554.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] Length = 93 Score = 154 bits (389), Expect = 3e-36, Method: Composition-based stats. Identities = 93/93 (100%), Positives = 93/93 (100%) Query: 1 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD 60 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD Sbjct: 1 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD 60 Query: 61 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE 93 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE Sbjct: 61 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE 93 >gi|45201038|ref|NP_986608.1| AGL058Cp [Ashbya gossypii ATCC 10895] gi|44985808|gb|AAS54432.1| AGL058Cp [Ashbya gossypii ATCC 10895] Length = 969 Score = 37.8 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 20/78 (25%), Positives = 42/78 (53%) Query: 9 YAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISD 68 Y EE +S+ L L+ A D I+++E+S+L ++ ++ K+ ++D K ++ S ++ Sbjct: 615 YQEEIHSLELQLEEAHDKLLISAEEISELHEKIAHIESEKNAIIDEKKDIVESLMSAKAE 674 Query: 69 FHRNSESELVRCSDSESE 86 F + + L E+E Sbjct: 675 FQQREQEHLTATEQLETE 692 >gi|194226990|ref|XP_001489883.2| PREDICTED: similar to hCG2042154 [Equus caballus] Length = 672 Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 4/64 (6%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQ-ITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFG 63 +C+AY +R D+D + D+ Q +T DE DLTQ+Y Y L+ + N +S+ + Sbjct: 260 VCQAYLGQREHE--DIDISEDAVQDLTEDEWKDLTQQY-YALVQGDAFISNSRSHFSQCQ 316 Query: 64 SLIS 67 +L++ Sbjct: 317 ALLN 320 >gi|296224434|ref|XP_002758058.1| PREDICTED: cytosolic 5'-nucleotidase 1B isoform 3 [Callithrix jacchus] Length = 592 Score = 35.1 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Query: 8 AYAEERYSVLLDLD---FASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 AY + + V D D F+ +S+ T + D +YD L +K L LK +L+ G Sbjct: 438 AYCDTQLRVAFDGDAVLFSDESEHFTKEHGMDKFFQYDTLCESKPLAQGPLKGFLEDLGR 497 Query: 65 LISDFHRNSESEL 77 L FH +E L Sbjct: 498 LQKKFHAKNERLL 510 >gi|296224432|ref|XP_002758057.1| PREDICTED: cytosolic 5'-nucleotidase 1B isoform 2 [Callithrix jacchus] Length = 609 Score = 35.1 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Query: 8 AYAEERYSVLLDLD---FASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 AY + + V D D F+ +S+ T + D +YD L +K L LK +L+ G Sbjct: 455 AYCDTQLRVAFDGDAVLFSDESEHFTKEHGMDKFFQYDTLCESKPLAQGPLKGFLEDLGR 514 Query: 65 LISDFHRNSESEL 77 L FH +E L Sbjct: 515 LQKKFHAKNERLL 527 >gi|296224430|ref|XP_002758056.1| PREDICTED: cytosolic 5'-nucleotidase 1B isoform 1 [Callithrix jacchus] Length = 626 Score = 35.1 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Query: 8 AYAEERYSVLLDLD---FASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 AY + + V D D F+ +S+ T + D +YD L +K L LK +L+ G Sbjct: 472 AYCDTQLRVAFDGDAVLFSDESEHFTKEHGMDKFFQYDTLCESKPLAQGPLKGFLEDLGR 531 Query: 65 LISDFHRNSESEL 77 L FH +E L Sbjct: 532 LQKKFHAKNERLL 544 >gi|149017521|gb|EDL76525.1| rCG59308, isoform CRA_b [Rattus norvegicus] Length = 475 Score = 35.1 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +DL AS ++ ++ +E +DLTQ+Y YLL++ + + + +SY + + Sbjct: 75 VCQAYLGQLEHEDIDLSDAS-AEALSEEEWNDLTQQY-YLLVHGNASITDSRSYFAQCQA 132 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 133 LLSKISSVNPQTEI 146 >gi|149017522|gb|EDL76526.1| rCG59308, isoform CRA_c [Rattus norvegicus] Length = 588 Score = 35.1 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +DL AS ++ ++ +E +DLTQ+Y YLL++ + + + +SY + + Sbjct: 75 VCQAYLGQLEHEDIDLSDAS-AEALSEEEWNDLTQQY-YLLVHGNASITDSRSYFAQCQA 132 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 133 LLSKISSVNPQTEI 146 >gi|66911735|gb|AAH97453.1| RGD1306462 protein [Rattus norvegicus] Length = 375 Score = 35.1 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +DL AS ++ ++ +E +DLTQ+Y YLL++ + + + +SY + + Sbjct: 263 VCQAYLGQLEHEDIDLSDAS-AEALSEEEWNDLTQQY-YLLVHGNASITDSRSYFAQCQA 320 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 321 LLSKISSVNPQTEI 334 >gi|295293121|ref|NP_766406.2| protein monoglycylase TTLL8 [Mus musculus] gi|172044389|sp|A4Q9F1|TTLL8_MOUSE RecName: Full=Protein monoglycylase TTLL8; AltName: Full=Tubulin--tyrosine ligase-like protein 8 gi|145369184|emb|CAM84329.1| glycylase [Mus musculus] gi|148672443|gb|EDL04390.1| RIKEN cDNA 1700019P01, isoform CRA_b [Mus musculus] Length = 832 Score = 34.7 bits (78), Expect = 3.8, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +D+ AS ++ ++ +E +DLTQ+Y YLL++ + + + KSY + + Sbjct: 316 VCQAYLGQLEHEDIDVSEAS-TEALSEEEWNDLTQQY-YLLVHGNASITDSKSYFAQCQA 373 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 374 LLSKISSVNPQTEI 387 >gi|109732579|gb|AAI16295.1| Ttll8 protein [Mus musculus] Length = 634 Score = 34.7 bits (78), Expect = 3.8, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +D+ AS ++ ++ +E +DLTQ+Y YLL++ + + + KSY + + Sbjct: 118 VCQAYLGQLEHEDIDVSEAS-TEALSEEEWNDLTQQY-YLLVHGNASITDSKSYFAQCQA 175 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 176 LLSKISSVNPQTEI 189 >gi|26325682|dbj|BAC26595.1| unnamed protein product [Mus musculus] gi|148672442|gb|EDL04389.1| RIKEN cDNA 1700019P01, isoform CRA_a [Mus musculus] Length = 518 Score = 34.7 bits (78), Expect = 3.8, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +D+ AS ++ ++ +E +DLTQ+Y YLL++ + + + KSY + + Sbjct: 118 VCQAYLGQLEHEDIDVSEAS-TEALSEEEWNDLTQQY-YLLVHGNASITDSKSYFAQCQA 175 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 176 LLSKISSVNPQTEI 189 >gi|26326135|dbj|BAC26811.1| unnamed protein product [Mus musculus] gi|109730773|gb|AAI16294.1| Tubulin tyrosine ligase-like family, member 8 [Mus musculus] Length = 781 Score = 34.7 bits (78), Expect = 3.8, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Query: 5 MCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 +C+AY + +D+ AS ++ ++ +E +DLTQ+Y YLL++ + + + KSY + + Sbjct: 265 VCQAYLGQLEHEDIDVSEAS-TEALSEEEWNDLTQQY-YLLVHGNASITDSKSYFAQCQA 322 Query: 65 LISDFHR-NSESEL 77 L+S N ++E+ Sbjct: 323 LLSKISSVNPQTEI 336 >gi|221057748|ref|XP_002261382.1| SICA antigen (fragment) [Plasmodium knowlesi strain H] gi|194247387|emb|CAQ40787.1| SICA antigen (fragment) [Plasmodium knowlesi strain H] Length = 1074 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 32/64 (50%) Query: 27 DQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISDFHRNSESELVRCSDSESE 86 D ITSD ++D + + + + ++D + + +L + + +S C+D +SE Sbjct: 627 DNITSDNITDYIDNHHHHITHPSYIIDPWEEVQTQLKNLSGEIQKKKDSVGSHCTDLQSE 686 Query: 87 EAKE 90 E KE Sbjct: 687 EEKE 690 >gi|168065993|ref|XP_001784929.1| predicted protein [Physcomitrella patens subsp. patens] gi|162663516|gb|EDQ50276.1| predicted protein [Physcomitrella patens subsp. patens] Length = 515 Score = 34.3 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 40/78 (51%) Query: 16 VLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISDFHRNSES 75 +L DL A+ T+ SDL + YD+L+ + L++ + + +D+ SD R + Sbjct: 66 LLNDLGLANHLRPQTAGFPSDLDETYDWLVALQDDLMEGIDAAVDQLAKQKSDGKRGRPN 125 Query: 76 ELVRCSDSESEEAKEGTE 93 E R +E +A +G++ Sbjct: 126 EKFRTPTNEGAKASKGSD 143 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.311 0.129 0.346 Lambda K H 0.267 0.0398 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 742,976,279 Number of Sequences: 14124377 Number of extensions: 24537524 Number of successful extensions: 62836 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 62822 Number of HSP's gapped (non-prelim): 25 length of query: 93 length of database: 4,842,793,630 effective HSP length: 63 effective length of query: 30 effective length of database: 3,952,957,879 effective search space: 118588736370 effective search space used: 118588736370 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 75 (33.5 bits)