RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) >gnl|CDD|147389 pfam05180, zf-DNL, DNL zinc finger. The domain is named after a short C-terminal motif of D(N/H)L. This domain is a novel zinc-finger protein essential for protein import into mitochondria. Length = 66 Score = 26.8 bits (60), Expect = 1.4 Identities = 10/31 (32%), Positives = 12/31 (38%), Gaps = 8/31 (25%) Query: 47 NKHLLVDNLKSYLDKFGSLISDFHRNSESEL 77 N+HL+ DNL D N E L Sbjct: 37 NRHLIADNLG--------WFGDGKVNIEDIL 59 >gnl|CDD|36289 KOG1071, KOG1071, KOG1071, Mitochondrial translation elongation factor EF-Tsmt, catalyzes nucleotide exchange on EF-Tumt [Translation, ribosomal structure and biogenesis]. Length = 340 Score = 25.0 bits (54), Expect = 4.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 54 NLKSYLDKFGSLISDFHRNSESELVRCSDSE 84 +K YLD + DF R E R +++E Sbjct: 310 TVKEYLDPHNVSVVDFVRFEVGEGERAAETE 340 >gnl|CDD|29029 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases. Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like.. Length = 139 Score = 24.0 bits (52), Expect = 9.1 Identities = 7/28 (25%), Positives = 10/28 (35%) Query: 53 DNLKSYLDKFGSLISDFHRNSESELVRC 80 ++ Y D+ I D LV C Sbjct: 61 QDISKYFDEAVDFIDDAREKGGKVLVHC 88 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.311 0.129 0.346 Gapped Lambda K H 0.267 0.0663 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,007,831 Number of extensions: 43326 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 16 Length of query: 93 Length of database: 6,263,737 Length adjustment: 61 Effective length of query: 32 Effective length of database: 4,945,588 Effective search space: 158258816 Effective search space used: 158258816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.6 bits)