RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) >gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase. Length = 529 Score = 26.3 bits (58), Expect = 1.7 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Query: 49 HLLVDNLKSYLDKFGSLISDFHRNS-----ESELVRCSDSESEEAKE 90 HLLVD+L +L + S DF S + + ++C D AK Sbjct: 286 HLLVDDLAKFLQTYSS--PDFAGFSCTIPHKEDALKCCDEVDPIAKS 330 >gnl|CDD|178157 PLN02542, PLN02542, fructose-1,6-bisphosphatase. Length = 412 Score = 26.0 bits (57), Expect = 2.4 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 15/40 (37%) Query: 47 NKHLLVDNLKSYLDKF---------------GSLISDFHR 71 N L D LK Y+D GSL+ DFHR Sbjct: 295 NYQLWDDKLKKYIDDLKDPGPSGKPYSARYIGSLVGDFHR 334 >gnl|CDD|182459 PRK10436, PRK10436, hypothetical protein; Provisional. Length = 462 Score = 26.0 bits (58), Expect = 2.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 26 SDQITSDELSDLTQRYDYLLLNK 48 S+++ D+L L QRY +LL+ Sbjct: 1 SNEMNIDQLHALCQRYQAVLLDS 23 >gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional. Length = 420 Score = 25.7 bits (56), Expect = 2.5 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Query: 13 RYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISDFHRN 72 ++ VL+D S DQ+ +++++ L+Q + KHLL+ N S D +IS + + Sbjct: 270 KHMVLIDTVGMSQRDQMLAEQIAMLSQCGTQV---KHLLLLNATSSGDTLDEVISAYQGH 326 Query: 73 S 73 Sbjct: 327 G 327 >gnl|CDD|179149 PRK00872, PRK00872, hypothetical protein; Provisional. Length = 157 Score = 25.4 bits (56), Expect = 3.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 20 LDFASDSDQITSDELSDLTQRY 41 L +D I D L+DL RY Sbjct: 55 LPGGADWQIIRPDGLTDLEARY 76 >gnl|CDD|165098 PHA02730, PHA02730, ankyrin-like protein; Provisional. Length = 672 Score = 25.0 bits (54), Expect = 4.3 Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 20 LDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISDFHRN 72 L++ + + + ++ Q+ Y NK LVD L SY ++I F+R+ Sbjct: 482 LEYGASVNTTSRSIINTAIQKSSYRRENKTKLVDLLLSYHPTLETMIDAFNRD 534 >gnl|CDD|178541 PLN02955, PLN02955, 8-amino-7-oxononanoate synthase. Length = 476 Score = 25.0 bits (54), Expect = 4.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 12 ERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLL 46 +R V+ D F+ D D +ELS L ++Y +LL+ Sbjct: 249 KRKVVVTDSLFSMDGDFAPMEELSQLRKKYGFLLV 283 >gnl|CDD|172324 PRK13787, PRK13787, adenylosuccinate synthetase; Provisional. Length = 423 Score = 24.9 bits (54), Expect = 4.6 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 13 RYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLI--SDFH 70 R LLD + + ++ +L + Y ++ + + D LK +L K G I + ++ Sbjct: 148 RVGDLLDKSYKRRLKHLVDEKNRELDKLYGMPPVSYNDINDGLKFFLSKVGKNIINTAYY 207 Query: 71 RNSESE 76 ++E + Sbjct: 208 LDTELK 213 >gnl|CDD|171532 PRK12482, PRK12482, flagellar motor protein MotA; Provisional. Length = 287 Score = 24.7 bits (54), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Query: 27 DQ-ITSDELSDLTQRYDYLLLNKHLL---VDNLK 56 DQ I E S L Q+Y +L K L+ DN + Sbjct: 98 DQHIEIPEESSLFQKYPLILQQKRLITFISDNFR 131 >gnl|CDD|131967 TIGR02921, PEP_integral, PEP-CTERM family integral membrane protein. Members of this protein family, found in three different species so far, have a PEP-CTERM sequence at the carboxyl-terminus (see model TIGR02595), but are unusual among PEP-CTERM proteins in having multiple predicted transmembrane segments. The function is unknown. It is proposed that a member of the EpsH family, to be designated exosortase (see TIGR02602), recognizes and cleaves PEP-CTERM proteins in a manner analogous to the cleavage of LPXTG proteins by sortase (see Haft, et al., 2006). Length = 952 Score = 24.2 bits (52), Expect = 6.7 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 3/74 (4%) Query: 19 DLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLISDFHRNSE--SE 76 D D A + + +D + R L K + +D+LKS LD ++ H S+ S Sbjct: 823 DADAALSNAKQEADFFPAIAARQLIEGLAKQIDLDDLKS-LDAIHAIAKAEHIVSDYSSM 881 Query: 77 LVRCSDSESEEAKE 90 +V D + + +E Sbjct: 882 IVLVEDEQKKALEE 895 >gnl|CDD|181764 PRK09293, PRK09293, fructose-1,6-bisphosphatase; Provisional. Length = 327 Score = 24.4 bits (54), Expect = 6.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Query: 63 GSLISDFHRN 72 GS+++D HR Sbjct: 238 GSMVADVHRI 247 >gnl|CDD|147925 pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold. Length = 249 Score = 24.2 bits (53), Expect = 7.5 Identities = 7/28 (25%), Positives = 12/28 (42%) Query: 27 DQITSDELSDLTQRYDYLLLNKHLLVDN 54 + D + T YDYL+ N + + Sbjct: 151 AIVLKDGPKNKTPMYDYLIDNYKKKIPS 178 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.311 0.129 0.346 Gapped Lambda K H 0.267 0.0542 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,397,074 Number of extensions: 73619 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 22 Length of query: 93 Length of database: 5,994,473 Length adjustment: 61 Effective length of query: 32 Effective length of database: 4,676,385 Effective search space: 149644320 Effective search space used: 149644320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.5 bits)