RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Score = 24.6 bits (53), Expect = 2.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 63 GSLISDFHRNSESELVRCSDSESEEAKE 90 G++ DF ++ LV SDS +E Sbjct: 100 GTIRGDFALETQFNLVHGSDSAESAQRE 127 >d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 140 Score = 23.3 bits (49), Expect = 5.4 Identities = 9/44 (20%), Positives = 15/44 (34%) Query: 9 YAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLV 52 Y +E S+ F D D + ++ +L L V Sbjct: 3 YVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSV 46 >d2d1pb1 c.114.1.1 (B:1-119) tRNA 2-thiouridine synthesizing protein C, TusC {Escherichia coli [TaxId: 562]} Length = 119 Score = 23.3 bits (50), Expect = 5.7 Identities = 7/43 (16%), Positives = 15/43 (34%) Query: 3 EIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLL 45 + A + + F ++ + +D L YD +L Sbjct: 75 QCWVCAASLRERGLDPQTPFVVEATPLEADALRRELANYDVIL 117 >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Score = 23.1 bits (49), Expect = 7.1 Identities = 9/44 (20%), Positives = 17/44 (38%) Query: 47 NKHLLVDNLKSYLDKFGSLISDFHRNSESELVRCSDSESEEAKE 90 + + L+ + G++ D + L+ SDSE E Sbjct: 79 DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDE 122 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.311 0.129 0.346 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 310,281 Number of extensions: 11587 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's gapped: 31 Number of HSP's successfully gapped: 9 Length of query: 93 Length of database: 2,407,596 Length adjustment: 56 Effective length of query: 37 Effective length of database: 1,638,716 Effective search space: 60632492 Effective search space used: 60632492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 47 (22.2 bits)