Query         gi|254781082|ref|YP_003065495.1| hypothetical protein CLIBASIA_04920 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 108
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 21:14:09 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781082.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3h4j_B AMPK kdaid, SNF1-like   54.6      11 0.00033   19.1   2.9   41   17-57     24-64  (65)
  2 >2zet_C Melanophilin; complex,  42.3      11 0.00032   19.2   1.3   26   29-54      7-32  (113)
  3 >2h5g_A Delta 1-pyrroline-5-ca  37.8      14  0.0004   18.7   1.2   44    8-51     17-60  (303)
  4 >2nqb_D Histone H2B; nucleosom  37.3      17 0.00049   18.1   1.6   13   59-71     61-73  (123)
  5 >3k8x_A Acetyl-COA carboxylase  33.4      35   0.001   16.2   2.8   31    9-40      3-37  (117)
  6 >2hqy_A Conserved hypothetical  20.2      51  0.0015   15.3   1.6   33   36-68      4-39  (133)
  7 >1tzy_B Histone H2B; histone-f  19.0      56  0.0017   15.1   1.6   12   60-71     65-76  (126)
  8 >1j2m_A CPI-17, 17-kDa PKC-pot  19.0      71  0.0021   14.5   2.1   59    9-73     28-98  (99)
  9 >3ff6_A Acetyl-COA carboxylase  18.9      67   0.002   14.6   1.9   29    9-38      3-35  (72)
 10 >1svv_A Threonine aldolase; st  17.1      18 0.00053   18.0  -1.3   12   58-69     15-29  (119)

No 1  
>>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotein, serine/threonine-protein kinase; 2.80A {Schizosaccharomyces pombe} (B:272-336)
Probab=54.58  E-value=11  Score=19.14  Aligned_cols=41  Identities=27%  Similarity=0.311  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             41567999998348561132333056777688878734875
Q gi|254781082|r   17 LERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSS   57 (108)
Q Consensus        17 lernsivealrkakpsmsdlamlsveerdailddlekngss   57 (108)
                      ..|.-|.+||++..|+---=|.+-+.|-..+..|+.++-|-
T Consensus        24 Y~rdeI~eAL~~~e~neIkDAY~likEN~~l~~~l~~~ks~   64 (65)
T 3h4j_B           24 FSEDYIVEALRSDENNEVKEAYNLLHENQVIQEKLEHHHHH   64 (65)
T ss_dssp             CCHHHHHHHTTSSSCCSSTTHHHHHHHHHHHHHHHHSCC--
T ss_pred             CCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999986767409999999998758889975340137


No 2  
>>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} (C:1-72,C:113-153)
Probab=42.28  E-value=11  Score=19.21  Aligned_cols=26  Identities=19%  Similarity=0.298  Sum_probs=21.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             48561132333056777688878734
Q gi|254781082|r   29 AKPSMSDLAMLSVEERDAILDDLEKN   54 (108)
Q Consensus        29 akpsmsdlamlsveerdailddlekn   54 (108)
                      +.|-|-||.-|+-|||++|+.-|...
T Consensus         7 ~~~~~~DLS~LTeeEre~Il~VL~Rd   32 (113)
T 2zet_C            7 GXGKRLDLSTLTDEEAEHVWAVVQRD   32 (113)
T ss_dssp             ----CCCCTTSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             65412213329999999999999978


No 3  
>>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.25A {Homo sapiens} (A:1-248,A:409-463)
Probab=37.83  E-value=14  Score=18.66  Aligned_cols=44  Identities=23%  Similarity=0.244  Sum_probs=33.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             23488888541567999998348561132333056777688878
Q gi|254781082|r    8 NREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDL   51 (108)
Q Consensus         8 nrefieywrlernsivealrkakpsmsdlamlsveerdailddl   51 (108)
                      |..+.+...-....+-+++++|+-....++.++.++|..+|..+
T Consensus        17 ~~~~~~~~~~~~~~i~~a~~~Ar~A~~~w~~~s~~~R~~iL~~~   60 (303)
T 2h5g_A           17 NLYFQSXVKPAGPTVEQQGEXARSGGRXLATLEPEQRAEIIHHL   60 (303)
T ss_dssp             ------------CCHHHHHHHHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             00210025777643999999999999999849999999999999


No 4  
>>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* (D:)
Probab=37.33  E-value=17  Score=18.14  Aligned_cols=13  Identities=54%  Similarity=0.887  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             2379999999999
Q gi|254781082|r   59 YSFVNDLWERLKY   71 (108)
Q Consensus        59 ysfvndlwerlky   71 (108)
                      -|||||+.||+-.
T Consensus        61 nSfvnDiFerIa~   73 (123)
T 2nqb_D           61 NSFVNDIFERIAA   73 (123)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 5  
>>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT, tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A (A:642-758)
Probab=33.41  E-value=35  Score=16.24  Aligned_cols=31  Identities=32%  Similarity=0.554  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHH----HHHHCCCCHHHHHHHH
Q ss_conf             3488888541567999----9983485611323330
Q gi|254781082|r    9 REFIEYWRLERNSIVE----ALRKAKPSMSDLAMLS   40 (108)
Q Consensus         9 refieywrlernsive----alrkakpsmsdlamls   40 (108)
                      |.|. ||||-|--.-+    .+..|-|+++....+.
T Consensus         3 R~fF-YwRLrRrL~Ee~l~k~i~~a~~~ls~~~~~~   37 (117)
T 3k8x_A            3 RRFF-FWRLRRRLNEEYLIKRLSHQVGEASRLEKIA   37 (117)
T ss_dssp             HHHH-HHHHHHHHHHHHHHHHHHTSSSCCCHHHHHH
T ss_pred             HHHH-HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             9999-9999998869999999987567767789999


No 6  
>>2hqy_A Conserved hypothetical protein; PSI2, MAD, structural genomics, protein structure initiative; HET: COA; 1.80A {Bacteroides thetaiotaomicron vpi-5482} (A:1-118,A:291-305)
Probab=20.16  E-value=51  Score=15.30  Aligned_cols=33  Identities=24%  Similarity=0.353  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHH--HCCCCCHHHHHH-HHHH
Q ss_conf             23330567776888787--348751237999-9999
Q gi|254781082|r   36 LAMLSVEERDAILDDLE--KNGSSDYSFVND-LWER   68 (108)
Q Consensus        36 lamlsveerdailddle--kngssdysfvnd-lwer   68 (108)
                      ..-++.+.++.|..-+.  ...+|||||.|- +|..
T Consensus         4 Fk~i~leDk~~i~~y~~~~~~~~sd~sF~Nl~lW~~   39 (133)
T 2hqy_A            4 FKDITLADRDTITAFTMKSDRRNCDLSFSNLCSWRF   39 (133)
T ss_dssp             CEECCGGGHHHHHHHHTTSCCCCGGGCHHHHHHTHH
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             677887579999999852899626631989997654


No 7  
>>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} (B:)
Probab=19.04  E-value=56  Score=15.07  Aligned_cols=12  Identities=58%  Similarity=0.949  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             379999999999
Q gi|254781082|r   60 SFVNDLWERLKY   71 (108)
Q Consensus        60 sfvndlwerlky   71 (108)
                      |||||+.||+-.
T Consensus        65 sfv~diferIa~   76 (126)
T 1tzy_B           65 SFVNDIFERIAG   76 (126)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 8  
>>1j2m_A CPI-17, 17-kDa PKC-potentiated inhibitory protein of PP1; helix bundle, protein binding; NMR {Sus scrofa} (A:)
Probab=19.01  E-value=71  Score=14.51  Aligned_cols=59  Identities=29%  Similarity=0.307  Sum_probs=37.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCH-----------HHHHHHHHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             3488888541567999998348561-----------132333056777-6888787348751237999999999974
Q gi|254781082|r    9 REFIEYWRLERNSIVEALRKAKPSM-----------SDLAMLSVEERD-AILDDLEKNGSSDYSFVNDLWERLKYLR   73 (108)
Q Consensus         9 refieywrlernsivealrkakpsm-----------sdlamlsveerd-ailddlekngssdysfvndlwerlkylr   73 (108)
                      |--+|-|      |.+.|++---..           .-|.|-|.|+|- .+-.-|..-++..-.|+++|-.|++-||
T Consensus        28 rL~~E~W------I~~qL~eLY~~~e~~~p~eIDiDeLLdl~s~e~R~~~LqelL~~c~kPtE~FI~eLL~klkgl~   98 (99)
T 1j2m_A           28 RLDVEKW------IDGRLEELYRGREADMPDEVNIDELLELESEEERSRKIQGLLKSCTNPTENFVQELLVKLRGLH   98 (99)
T ss_dssp             HHHHHHH------HHHHHHHSCTTSSCSCCSSCCSHHHHCCTTTTHHHHHHHHHHHTTSCCCHHHHHHHHHHTTTTC
T ss_pred             HHHHHHH------HHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC
T ss_conf             9879999------9999999865864469865579999705654899999999997669986999999999998611


No 9  
>>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens} (A:630-701)
Probab=18.88  E-value=67  Score=14.65  Aligned_cols=29  Identities=31%  Similarity=0.677  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHH----CCCCHHHHHH
Q ss_conf             34888885415679999983----4856113233
Q gi|254781082|r    9 REFIEYWRLERNSIVEALRK----AKPSMSDLAM   38 (108)
Q Consensus         9 refieywrlernsivealrk----akpsmsdlam   38 (108)
                      |.| =||||-|--.-|.+.|    |-|++|....
T Consensus         3 R~f-FYwRLrRrl~Ee~l~K~i~~a~~~ls~~~a   35 (72)
T 3ff6_A            3 RTF-LYWRLRRLLLEDQVKQEILQASGELSHVHI   35 (72)
T ss_dssp             HHH-HHHHHHHHHHHHHHHTTTTHHHHCCCHHHH
T ss_pred             HHH-HHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             999-999999988579999999861778898999


No 10 
>>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic protozoa, SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} (A:1-23,A:264-359)
Probab=17.06  E-value=18  Score=17.97  Aligned_cols=12  Identities=67%  Similarity=1.007  Sum_probs=5.9

Q ss_pred             CHHHHHH---HHHHH
Q ss_conf             1237999---99999
Q gi|254781082|r   58 DYSFVND---LWERL   69 (108)
Q Consensus        58 dysfvnd---lwerl   69 (108)
                      .||||||   ||+++
T Consensus        15 ~~~~~~~~~~L~~~l   29 (119)
T 1svv_A           15 PYSFVNDYSNLFFEL   29 (119)
T ss_dssp             CEECSCSCSTHHHHH
T ss_pred             CCCCCCCCCHHHHHH
T ss_conf             777566678156789


Done!