BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781082|ref|YP_003065495.1| hypothetical protein
CLIBASIA_04920 [Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781082|ref|YP_003065495.1| hypothetical protein CLIBASIA_04920 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040759|gb|ACT57555.1| hypothetical protein CLIBASIA_04920 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 108

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYS 60
           MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYS
Sbjct: 1   MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYS 60

Query: 61  FVNDLWERLKYLRDLPVYNFSLDYVSRFHSFVSDEVAVWYEVTKEKKK 108
           FVNDLWERLKYLRDLPVYNFSLDYVSRFHSFVSDEVAVWYEVTKEKKK
Sbjct: 61  FVNDLWERLKYLRDLPVYNFSLDYVSRFHSFVSDEVAVWYEVTKEKKK 108


>gi|17507139|ref|NP_493619.1| hypothetical protein F33H2.2 [Caenorhabditis elegans]
 gi|3876644|emb|CAB04264.1| C. elegans protein F33H2.2, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 816

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 14/88 (15%)

Query: 14  YWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKN-----GSSDYSFVNDLWER 68
           +WR    SI+E         SD+  L+ EE+  I   L+ N     G   YS V  L++R
Sbjct: 168 WWRTNVGSILE---------SDVKTLNEEEKQVIDRLLDTNVAIPAGLLKYSVVTSLYDR 218

Query: 69  LKYLRDLPVYNFSLDYVSRFHSFVSDEV 96
                D+PVY+    YV+    FV + V
Sbjct: 219 GLIYFDVPVYDNDYIYVAPLDGFVMNRV 246


>gi|323698858|ref|ZP_08110770.1| SMC domain protein [Desulfovibrio sp. ND132]
 gi|323458790|gb|EGB14655.1| SMC domain protein [Desulfovibrio desulfuricans ND132]
          Length = 569

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 10/96 (10%)

Query: 4   DVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVN 63
           D+ + REF+EY + E  S+       +P   D     +EER  IL D E+ G    + ++
Sbjct: 196 DLQKQREFLEYQKKEIESV-----DPQPDEED----DLEERKKILKDRERAGECLQNALD 246

Query: 64  DLWERLKYLRDLPVYNFSLDYVSR-FHSFVSDEVAV 98
            L   +  L  + + N  ++ ++R F  F  D  AV
Sbjct: 247 ILHGEVGMLDAMTLLNREMEIIARLFPGFEEDREAV 282


>gi|123433912|ref|XP_001308706.1| Beige/BEACH domain containing protein [Trichomonas vaginalis G3]
 gi|121890399|gb|EAX95776.1| Beige/BEACH domain containing protein [Trichomonas vaginalis G3]
          Length = 2414

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 33/70 (47%)

Query: 19   RNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVY 78
            RN I E L KA    S +A+  V +   IL   +   S D  F N + + + YL   P+ 
Sbjct: 1179 RNKIYELLVKAFSDKSRVALNFVVQEIGILPFAQSLSSDDEDFRNQVLQLISYLCISPMV 1238

Query: 79   NFSLDYVSRF 88
                DYVS++
Sbjct: 1239 KLKFDYVSQY 1248


>gi|322711913|gb|EFZ03486.1| myosin-5 [Metarhizium anisopliae ARSEF 23]
          Length = 1238

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 19  RNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEK--NGSSDYSFVNDLWERLKYLRDLP 76
           + +  EA +K +  +SDL +LS    +AI D+L+K   G+  Y+++  +   +   RDL 
Sbjct: 51  KKATFEATKKKEIGVSDLTLLSKVSNEAINDNLKKRFEGAEIYTYIGHVLVSVNPFRDLG 110

Query: 77  VY 78
           +Y
Sbjct: 111 IY 112


>gi|322694518|gb|EFY86346.1| myosin-5 [Metarhizium acridum CQMa 102]
          Length = 1218

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 19 RNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEK--NGSSDYSFVNDLWERLKYLRDLP 76
          + +  EA +K +  +SDL +LS    +AI D+L+K   G+  Y+++  +   +   RDL 
Sbjct: 31 KKATFEATKKKEIGVSDLTLLSKVSNEAINDNLKKRFEGAEIYTYIGHVLVSVNPFRDLG 90

Query: 77 VY 78
          +Y
Sbjct: 91 IY 92


>gi|61656787|emb|CAH10048.1| Cell Division Protein AAA ATPase family [Triticum aestivum]
 gi|109450904|emb|CAJ13544.1| unnamed protein product [Triticum aestivum]
          Length = 496

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 16  RLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDL--EKNGSSDYSFVNDLWER 68
           R  RNS+ + ++   P+  D   +  ++++AI+DDL   K+G   Y+ V   W+R
Sbjct: 190 RYLRNSVWDYVKFEHPATFDTLAMDTDQKEAIMDDLIAFKDGKEYYTKVGKAWKR 244


>gi|294932603|ref|XP_002780355.1| mucolipin, putative [Perkinsus marinus ATCC 50983]
 gi|239890277|gb|EER12150.1| mucolipin, putative [Perkinsus marinus ATCC 50983]
          Length = 510

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 8   NREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWE 67
           N     YW ++R S+ +    ++P +  +  L+ +++  +LDD  +   +   F+N + +
Sbjct: 116 NNTLEHYWHIDRKSLSDFRHLSQPPVLHILWLNGDQQRMVLDDAWEEDPAYGHFINSV-D 174

Query: 68  RLKYLRDL 75
           RLK +RD+
Sbjct: 175 RLKRIRDM 182


>gi|294932601|ref|XP_002780354.1| mucolipin, putative [Perkinsus marinus ATCC 50983]
 gi|239890276|gb|EER12149.1| mucolipin, putative [Perkinsus marinus ATCC 50983]
          Length = 515

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 8   NREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWE 67
           N     YW ++R S+ +    ++P +  +  L+ +++  +LDD  +   +   F+N + +
Sbjct: 116 NNTLEHYWHIDRKSLSDFRHLSQPPVLHILWLNGDQQRMVLDDAWEEDPAYGHFINSV-D 174

Query: 68  RLKYLRDL 75
           RLK +RD+
Sbjct: 175 RLKRIRDM 182


>gi|311067235|ref|YP_003972158.1| iron-dicitrate ABC transporter binding lipoprotein [Bacillus
           atrophaeus 1942]
 gi|310867752|gb|ADP31227.1| iron-dicitrate ABC transporter (binding lipoprotein) [Bacillus
           atrophaeus 1942]
          Length = 317

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 12/75 (16%)

Query: 23  VEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVYNFSL 82
           +E L K  P   D+  +S  E   I+DD +KN          LW+ LK +++  +Y+   
Sbjct: 244 LEQLSKIDP---DILFISANEGKTIVDDWKKN---------PLWKNLKAVKNGQIYDADR 291

Query: 83  DYVSRFHSFVSDEVA 97
           D  +RF    S E +
Sbjct: 292 DIWTRFRGIQSSETS 306


>gi|74629286|sp|Q7Z8J6|MYO1_USTMA RecName: Full=Myosin-1; AltName: Full=Class I unconventional
          myosin; AltName: Full=Type I myosin
 gi|32879541|emb|CAE11865.1| myosin 1 [Ustilago maydis]
          Length = 1282

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 24 EALRKAKPSMSDLAMLSVEERDAILDDLEK--NGSSDYSFVNDLWERLKYLRDLPVY 78
          E  +KA+  +SD+ +LS    +AI D+L+K    +  Y+++ ++   +   RDL +Y
Sbjct: 37 EGFKKAQAGVSDMTLLSKVTNEAINDNLQKRFQNAEIYTYIGNVLISVNPFRDLGIY 93


>gi|71020057|ref|XP_760259.1| hypothetical protein UM04112.1 [Ustilago maydis 521]
 gi|46099942|gb|EAK85175.1| hypothetical protein UM04112.1 [Ustilago maydis 521]
          Length = 3023

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 24   EALRKAKPSMSDLAMLSVEERDAILDDLEK--NGSSDYSFVNDLWERLKYLRDLPVY 78
            E  +KA+  +SD+ +LS    +AI D+L+K    +  Y+++ ++   +   RDL +Y
Sbjct: 1778 EGFKKAQAGVSDMTLLSKVTNEAINDNLQKRFQNAEIYTYIGNVLISVNPFRDLGIY 1834


>gi|332702601|ref|ZP_08422689.1| Valyl-tRNA synthetase [Desulfovibrio africanus str. Walvis Bay]
 gi|332552750|gb|EGJ49794.1| Valyl-tRNA synthetase [Desulfovibrio africanus str. Walvis Bay]
          Length = 893

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 1   MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYS 60
           M  D+  +   IE +R   N +  A R    ++ + A  + +ER+A L     +GS    
Sbjct: 559 MGRDIKLSEARIEGYRHFVNKLWNAARFTLMNLEEWAPQAPQEREAALKATPSSGSLHNQ 618

Query: 61  FVNDLWERLKYLRDLPVYNFSL-DYVSRFHSFVSDEVAVWY 100
           ++    E++K   D  +  ++  DY    ++FV  E   WY
Sbjct: 619 WILSRLEQVKTEVDAAIQGYAFNDYAQTLYAFVWREFCDWY 659


>gi|309359709|emb|CAP32576.2| hypothetical protein CBG_13852 [Caenorhabditis briggsae AF16]
          Length = 1410

 Score = 33.9 bits (76), Expect = 6.8,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 2    NTDVSRNREFIEY-WRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSS 57
            N ++ R RE + Y W +E N   E +RKA  + S    L + ER+ IL+   + GSS
Sbjct: 1147 NVEIQRIREELNYKWLVEHNKAKEEMRKASEAESKARQLMI-EREKILEQSNRFGSS 1202


>gi|85091800|ref|XP_959079.1| hypothetical protein NCU09169 [Neurospora crassa OR74A]
 gi|28920477|gb|EAA29843.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 324

 Score = 33.9 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 5/90 (5%)

Query: 17  LERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLP 76
           L  + +VE  +K  P     A       D  LD+L+  G  DY    +L E    L    
Sbjct: 231 LTGDQVVEGFKKVFPEAGATASYYQVPGDVYLDNLKGAGMPDY-VAQELLENFLLLGTFG 289

Query: 77  VYNF-SLDYVSRFHSFVSDEVAVWYEVTKE 105
            Y   SLD+    HS V D++  W E  K+
Sbjct: 290 YYGGESLDWT---HSLVEDKLTTWEEFIKK 316


>gi|118082074|ref|XP_425422.2| PREDICTED: similar to RAD50-interacting protein 1 [Gallus gallus]
          Length = 768

 Score = 33.5 bits (75), Expect = 9.3,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 6   SRNREFIEYWRLERNSIVEALRKAKPSMSDLAML--SVEERDAILDDLE--------KNG 55
           S NR  +E   L  +SI   L KA+P M DL +L   VEE +  L  L+         + 
Sbjct: 84  SLNR-LLEEETLLSDSISSHLEKAEPWMEDLGVLISQVEEIERHLSYLKWISRIEELSDN 142

Query: 56  SSDYSFVNDLWERLKYLRDLPVYNFSLDYVSRFH--SFVSDEVAVWYEVTKEK 106
              Y   N++ E    L  +   +  L   S  H  SFV   V  W+++ K+K
Sbjct: 143 IQQYLMTNNVPEAASTLASMAELDIKLQESSCSHLLSFVRSTVKFWHKILKDK 195


>gi|313673638|ref|YP_004051749.1| fes cluster assembly scaffold protein nifu [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940394|gb|ADR19586.1| FeS cluster assembly scaffold protein NifU [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 146

 Score = 33.5 bits (75), Expect = 9.7,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 36/70 (51%)

Query: 1   MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYS 60
           M T++ + +   E   L  N+IVEAL    P+    ++++ E  +A L D  K    D S
Sbjct: 72  MATELLKGKTVEEVLELTNNAIVEALDGLPPAKIHCSVMAEEAIEAALKDYYKRIGKDPS 131

Query: 61  FVNDLWERLK 70
            V+++  ++K
Sbjct: 132 IVDEMKAKIK 141


>gi|258597921|ref|XP_001348838.2| biotin carboxylase subunit of acetyl CoA carboxylase, putative
            [Plasmodium falciparum 3D7]
 gi|255528926|gb|AAN37277.2| biotin carboxylase subunit of acetyl CoA carboxylase, putative
            [Plasmodium falciparum 3D7]
          Length = 3367

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 10/95 (10%)

Query: 6    SRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDY-----S 60
            ++ R F  Y+RL R  ++  L +      D A++  EE + IL+DL  +   DY      
Sbjct: 3264 NKARSFF-YYRLMRRLLINILSRK----YDNALIKNEEIENILNDLNNSEDDDYIVCNRV 3318

Query: 61   FVNDLWERLKYLRDLPVYNFSLDYVSRFHSFVSDE 95
            F N++   LKY     +YN +L+   +    +S E
Sbjct: 3319 FNNNILRNLKYDTKDIIYNKTLNDFLKIFKMLSQE 3353


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.317    0.132    0.383 

Lambda     K      H
   0.267   0.0404    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 987,102,263
Number of Sequences: 14124377
Number of extensions: 34961288
Number of successful extensions: 112989
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 23
Number of HSP's that attempted gapping in prelim test: 112978
Number of HSP's gapped (non-prelim): 32
length of query: 108
length of database: 4,842,793,630
effective HSP length: 76
effective length of query: 32
effective length of database: 3,769,340,978
effective search space: 120618911296
effective search space used: 120618911296
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 75 (33.5 bits)