RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781082|ref|YP_003065495.1| hypothetical protein CLIBASIA_04920 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|38911 KOG3707, KOG3707, KOG3707, Uncharacterized conserved protein [Function unknown]. Length = 844 Score = 35.0 bits (80), Expect = 0.005 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 17/89 (19%) Query: 14 YWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSS-----DYSFVNDLWER 68 +WR+ + +E D LS +E A +D L ++ D V L++R Sbjct: 166 WWRVCLGNFLE---------EDFKKLSEDEM-ATIDKLCDEEANPAGLFDPEVVKSLYQR 215 Query: 69 -LKYLRDLPVYNFSLDYVSRFHSFVSDEV 96 L Y D+PVY VS FV + V Sbjct: 216 GLIYF-DVPVYQDDRIKVSPLEGFVMNRV 243 >gnl|CDD|32969 COG3155, ElbB, Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 217 Score = 31.5 bits (71), Expect = 0.057 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 18 ERNSIVEALRKAKPSMSDLAMLSVEERDAIL 48 RN +VE+ R A+ + LA EE DA++ Sbjct: 60 TRNVLVESARIARGEIRPLAQADAEELDALI 90 >gnl|CDD|153227 cd03133, GATase1_ES1, Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1. Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1. This group includes, proteins similar to ES1, Escherichia coli enhancing lycopene biosynthesis protein 2, Azospirillum brasilense iaaC and, human HES1. The catalytic triad typical of GATase1domains is not conserved in this GATase1-like domain. However, in common with GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Zebrafish ES1 is expressed specifically in adult photoreceptor cells and appears to be a cytoplasmic protein. A. brasilense iaaC is involved in controlling IAA biosynthesis. Length = 213 Score = 29.9 bits (68), Expect = 0.15 Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 19 RNSIVEALRKAKPSMSDLAMLSVEERDAIL 48 RN +VE+ R A+ ++ DLA L + DA++ Sbjct: 58 RNVLVESARIARGNIKDLAKLKAADFDALI 87 >gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19. Gamma-glutamyl phosphate reductase (GPR), a L-proline biosynthetic pathway (PBP) enzyme that catalyzes the NADPH dependent reduction of L-gamma-glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The glutamate route of the PBP involves two enzymatic steps catalyzed by gamma-glutamyl kinase (GK, EC 2.7.2.11) and GPR (EC 1.2.1.41). These enzymes are fused into the bifunctional enzyme, ProA or delta(1)-pyrroline-5-carboxylate synthetase (P5CS) in plants and animals, whereas they are separate enzymes in bacteria and yeast. In humans, the P5CS (ALDH18A1), an inner mitochondrial membrane enzyme, is essential to the de novo synthesis of the amino acids proline and arginine. Tomato (Lycopersicon esculentum) has both the prokaryotic-like polycistronic operons encoding GK and GPR (PRO1, ALDH19) and the full-length, bifunctional P5CS (PRO2, ALDH18B1). Length = 406 Score = 27.4 bits (62), Expect = 0.80 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Query: 23 VEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 E ++AK + LA LS E+++A L D LE N Sbjct: 1 EELAKRAKAASRALATLSTEQKNAALLAIADALEAN 36 >gnl|CDD|39031 KOG3827, KOG3827, KOG3827, Inward rectifier K+ channel [Inorganic ion transport and metabolism]. Length = 400 Score = 27.2 bits (60), Expect = 1.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 51 LEKNGSSDYSFVNDLWERLKYLRDL 75 ++K+G + F N +RL+YL+D+ Sbjct: 29 VKKDGHCNVQFKNVPRKRLRYLQDI 53 >gnl|CDD|38899 KOG3695, KOG3695, KOG3695, Uncharacterized conserved protein [Function unknown]. Length = 825 Score = 26.1 bits (57), Expect = 2.1 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Query: 26 LRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVY-NFSL 82 LR S+ L E+ + I +N F+ ++E+L+ + D +Y N L Sbjct: 621 LRDFINQKSNSLKLGEEKLEPIEPLESENFPFRGPFLQVIFEKLETILDNSLYVNLQL 678 >gnl|CDD|31360 COG1166, SpeA, Arginine decarboxylase (spermidine biosynthesis) [Amino acid transport and metabolism]. Length = 652 Score = 26.0 bits (57), Expect = 2.5 Identities = 13/56 (23%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Query: 9 REFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVND 64 + +EY + + ++ R+ + A L+ EE+ +L++LE G + Y+++ D Sbjct: 601 ADMLEYVQYDPKELLTLYRQ----QIEAADLTAEEQKQLLEELEA-GLNGYTYLED 651 >gnl|CDD|73263 cd01379, MYSc_type_III, Myosin motor domain, type III myosins. Myosin III has been shown to play a role in the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 653 Score = 25.7 bits (56), Expect = 2.8 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query: 33 MSDLAMLSVEERDAILDDLEKNGSSD--YSFVNDLWERLKYLRDLPVYN 79 M DLA L V + D I++ L+K ++ Y++V D+ + + L +Y Sbjct: 2 MDDLATLEVLDEDTIVEQLQKRYETNQIYTYVGDILIAVNPFQQLGLYT 50 >gnl|CDD|30364 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism]. Length = 417 Score = 25.5 bits (56), Expect = 2.9 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 19 RNSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 + + E ++AK + LA LS EE++ L D LE Sbjct: 2 MSELEELGKRAKAASRKLATLSTEEKNRALLAMADALEAA 41 >gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like. N-succinylglutamate 5-semialdehyde dehydrogenase or succinylglutamic semialdehyde dehydrogenase (SGSD, E. coli AstD, EC=1.2.1.71) involved in L-arginine degradation via the arginine succinyltransferase (AST) pathway and catalyzes the NAD+-dependent reduction of succinylglutamate semialdehyde into succinylglutamate. Length = 431 Score = 24.9 bits (55), Expect = 4.8 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 23 VEALRKAKPSMSDLAMLSVEERDAIL 48 V A R A P A LS+EER AIL Sbjct: 6 VAAARAAFPGW---AALSLEERAAIL 28 >gnl|CDD|147534 pfam05397, Med15_fungi, Mediator complex subunit 15. GAL11 or MED15 is one of the up to 32 or subunits of the Mediator complex which is found from fungi to humans. The Mediator complex interacts with RNA polymerase II and other general transcription factors to form the RNA polymerase II holoenzyme, thereby affecting transcription through targetting of activators and repressors. This family is found in fungi and the small metazoan starlet anemone. Length = 115 Score = 24.6 bits (54), Expect = 5.6 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 20 NSIVEALRKAKPSMSDLAM-LSVEERDAILDDLEKN 54 + E + K P + D+ L+ E++ AI L+KN Sbjct: 9 RQLYEEVAKNNPRLKDVTNTLTPEQKAAIRQQLQKN 44 >gnl|CDD|110038 pfam01007, IRK, Inward rectifier potassium channel. Length = 336 Score = 24.6 bits (54), Expect = 5.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 51 LEKNGSSDYSFVNDLWERLKYLRDL 75 + K+G + F N ER +YL+D+ Sbjct: 1 VSKDGRCNVYFKNVRGERGRYLQDI 25 >gnl|CDD|32681 COG2853, VacJ, Surface lipoprotein [Cell envelope biogenesis, outer membrane]. Length = 250 Score = 24.5 bits (53), Expect = 7.3 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query: 32 SMSDLAMLSVEERDAIL--DDLEKNGSSDYSFVNDLWER 68 S+ A+ +V+ R +L D+L KN Y FV D + + Sbjct: 183 SLGKWALQAVDTRAKLLDSDELLKNSPDPYIFVRDAYLQ 221 >gnl|CDD|144818 pfam01366, PRTP, Herpesvirus processing and transport protein. The members of this family are associate with capsid intermediates during packaging of the virus. Length = 635 Score = 24.1 bits (53), Expect = 7.7 Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 18 ERNSIVEALRKAKPSMSDLAMLSVEERDAILDD 50 R S + AL+ + ++ EE +A LD Sbjct: 244 RRPSALAALKAIQSRTAESDSGYREEAEAALDA 276 >gnl|CDD|110029 pfam00998, RdRP_3, Viral RNA dependent RNA polymerase. This family includes viral RNA dependent RNA polymerase enzymes from hepatitis C virus and various plant viruses. Length = 485 Score = 24.1 bits (53), Expect = 8.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 32 SMSDLAMLSVEERDAILDDLEK 53 ++ LA+ V+ RDAIL K Sbjct: 106 ALESLAVKPVQRRDAILKTFVK 127 >gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like. Kinetic studies of the Bacillus subtilis ALDH-like ycbD protein, which is involved in d-glucarate/d-galactarate utilization, reveal that it is a NADP+-dependent, alpha-ketoglutaric semialdehyde dehydrogenase (KGSADH). KGSADHs (EC 1.2.1.26) catalyze the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. Interestingly, the NADP+-dependent, tetrameric, 2,5-dioxopentanoate dehydrogenase (EC=1.2.1.26), an enzyme involved in the catabolic pathway for D-arabinose in Sulfolobus solfataricus, also clusters in this group. This CD shows a distant phylogenetic relationship to the Azospirillum brasilense KGSADH-II (-III) group. Length = 473 Score = 24.1 bits (53), Expect = 9.2 Identities = 10/37 (27%), Positives = 13/37 (35%) Query: 13 EYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILD 49 +Y R A+ A + S E R ILD Sbjct: 30 KYARASAEDADAAIAAAAAAFPAWRRTSPEARADILD 66 >gnl|CDD|146287 pfam03568, Peptidase_C50, Peptidase family C50. Length = 339 Score = 23.9 bits (52), Expect = 9.7 Identities = 7/30 (23%), Positives = 11/30 (36%), Gaps = 5/30 (16%) Query: 66 WERLKYLRDLPVY-----NFSLDYVSRFHS 90 WE L L++ V + + R S Sbjct: 221 WESLPILQEQSVSRVPSLHSLFSLLKRRKS 250 >gnl|CDD|34231 COG4594, FecB, ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]. Length = 310 Score = 23.8 bits (51), Expect = 9.9 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 15/87 (17%) Query: 24 EALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVYNFSLD 83 E L P D+ +L+ ++I+ EKN LW++LK +++ VY+ + Sbjct: 236 EQLAAINP---DVMILATYRDESIVRKWEKNA---------LWKKLKAVKNGQVYDVDRN 283 Query: 84 YVSRFHSFVSDEVA---VWYEVTKEKK 107 +R + E + + K KK Sbjct: 284 TWARSRGIDAAESMADELQKFMPKAKK 310 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0721 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,350,797 Number of extensions: 63710 Number of successful extensions: 223 Number of sequences better than 10.0: 1 Number of HSP's gapped: 222 Number of HSP's successfully gapped: 29 Length of query: 108 Length of database: 6,263,737 Length adjustment: 75 Effective length of query: 33 Effective length of database: 4,643,062 Effective search space: 153221046 Effective search space used: 153221046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)