RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781082|ref|YP_003065495.1| hypothetical protein
CLIBASIA_04920 [Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
          acyl-carrier-protein, beta-ketoacyl reductase,
          beta-ketoacyl synthase, dehydratase; 4.00A
          {Saccharomyces cerevisiae}
          Length = 2006

 Score = 35.7 bits (82), Expect = 0.002
 Identities = 11/51 (21%), Positives = 21/51 (41%), Gaps = 12/51 (23%)

Query: 56 SSDYSFVNDLWERLKYLRDLPVY--NFSLD--------YVSRFHSFVSDEV 96
          ++ +   + L E  ++ + LP     F+ D         V +F  +VS  V
Sbjct: 24 TASFFIASQLQE--QFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLV 72


>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genomics,
          JCSG, PSI, protein structure initiative; 2.00A
          {Thermotoga maritima} SCOP: c.82.1.1
          Length = 427

 Score = 32.5 bits (73), Expect = 0.021
 Identities = 5/39 (12%), Positives = 18/39 (46%), Gaps = 4/39 (10%)

Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          + ++E  +K + +   L   +  E++  +    + L++ 
Sbjct: 14 DELLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDER 52


>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase,
          structural genomics, structural genomics consortium,
          SGC, oxidoreductase; 2.25A {Homo sapiens}
          Length = 463

 Score = 29.7 bits (66), Expect = 0.17
 Identities = 9/39 (23%), Positives = 15/39 (38%), Gaps = 4/39 (10%)

Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
           ++ +    A+     LA L  E+R  I+    D L   
Sbjct: 29 PTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQ 67


>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural genomics,
          JCSG, protein structure initiative, PSI; 2.29A
          {Saccharomyces cerevisiae} SCOP: c.82.1.1
          Length = 468

 Score = 29.4 bits (65), Expect = 0.19
 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 4/39 (10%)

Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          +S  +  + A+ + + L  +S E R  IL    D L+ N
Sbjct: 14 SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKAN 52


>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI,
          MCSG, structural genomics, midwest center for STR
          genomics; 2.30A {Vibrio parahaemolyticus}
          Length = 452

 Score = 28.2 bits (62), Expect = 0.47
 Identities = 6/39 (15%), Positives = 16/39 (41%), Gaps = 7/39 (17%)

Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          ++++  ++KA+   +     S E+ D I         + 
Sbjct: 10 DAMIARVKKAQEEFATY---SQEQVDKIFRAASLAANQA 45


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 28.0 bits (61), Expect = 0.50
 Identities = 9/34 (26%), Positives = 17/34 (50%), Gaps = 12/34 (35%)

Query: 18 ERNSIVEALRKAKPSM---SD-----LAMLSVEE 43
          E+    +AL+K + S+   +D     LA+ +  E
Sbjct: 18 EK----QALKKLQASLKLYADDSAPALAIKATME 47


>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics,
          PSI-2, protein structure initiative; 2.00A {Listeria
          monocytogenes}
          Length = 464

 Score = 27.7 bits (60), Expect = 0.59
 Identities = 8/41 (19%), Positives = 19/41 (46%), Gaps = 7/41 (17%)

Query: 18 ERNSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          E  +++E+  KA+  ++ +   S ++ D I+    D     
Sbjct: 13 EVRNLIESANKAQKELAAM---SQQQIDTIVKAIADAGYGA 50


>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation
           termination, ATP-binding, cytoplasm, hydrolase,
           membrane; 2.80A {Schizosaccharomyces pombe}
          Length = 508

 Score = 27.0 bits (59), Expect = 1.0
 Identities = 15/73 (20%), Positives = 35/73 (47%), Gaps = 11/73 (15%)

Query: 21  SIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYL--RDLPVY 78
           ++++ +++ +    D+ +  ++E D +LD   + G  D S       R+K+L  R+  + 
Sbjct: 245 TVMDLMKRRQLDARDIKVFVLDEADNMLD---QQGLGDQSM------RIKHLLPRNTQIV 295

Query: 79  NFSLDYVSRFHSF 91
            FS  +  R   +
Sbjct: 296 LFSATFSERVEKY 308


>3fem_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel,
           synthase, biosynthetic protein, transferase; 3.02A
           {Saccharomyces cerevisiae}
          Length = 297

 Score = 26.6 bits (59), Expect = 1.4
 Identities = 10/60 (16%), Positives = 24/60 (40%), Gaps = 4/60 (6%)

Query: 22  IVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVYNFS 81
           + EA++  +    ++      + +  +  + +      S + D+ E       LPV NF+
Sbjct: 156 VSEAVKHIRRITEEIKACQQLKSEDDIAKVAEEMRVPVSLLKDVLE----KGKLPVVNFA 211


>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD,
          cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries}
          SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A*
          Length = 501

 Score = 26.2 bits (57), Expect = 2.2
 Identities = 9/29 (31%), Positives = 14/29 (48%)

Query: 23 VEALRKAKPSMSDLAMLSVEERDAILDDL 51
          V+A R+A    S    +   ER  +L+ L
Sbjct: 64 VKAARQAFQIGSPWRTMDASERGRLLNKL 92


>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH,
          isomerization, oxidoreductase; HET: NAD; 1.42A {Homo
          sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3inj_A*
          1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A*
          1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 2vle_A* 1cw3_A*
          1ag8_A 1a4z_A
          Length = 500

 Score = 26.1 bits (57), Expect = 2.2
 Identities = 9/36 (25%), Positives = 15/36 (41%), Gaps = 4/36 (11%)

Query: 23 VEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          V+A R A    S    +    R  +L    D +E++
Sbjct: 63 VKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERD 98


>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron,
           biosynthesis, [2Fe-2S], asymmetric trimer, three
           conserved Cys; 2.30A {Aquifex aeolicus}
          Length = 157

 Score = 26.1 bits (57), Expect = 2.2
 Identities = 15/59 (25%), Positives = 21/59 (35%), Gaps = 1/59 (1%)

Query: 1   MNTDVSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEE-RDAILDDLEKNGSSD 58
           M T++ + +       L    I E L    P       L +E    AI D L K G  +
Sbjct: 72  MLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQGRVE 130


>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT,
           tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid
           biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae}
           PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A
           1uyv_A
          Length = 758

 Score = 25.8 bits (56), Expect = 2.3
 Identities = 14/70 (20%), Positives = 23/70 (32%), Gaps = 8/70 (11%)

Query: 9   REFIEYWRLER----NSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVND 64
           R F  +WRL R      +++ L       S L  ++            ++   D      
Sbjct: 644 RRFF-FWRLRRRLNEEYLIKRLSHQVGEASRLEKIARIRSWYPASVDHED---DRQVATW 699

Query: 65  LWERLKYLRD 74
           + E  K L D
Sbjct: 700 IEENYKTLDD 709


>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP
          binding, oxidoreductase; HET: NAP; 2.30A {Escherichia
          coli}
          Length = 481

 Score = 25.4 bits (56), Expect = 3.0
 Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 7/36 (19%)

Query: 23 VEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          ++A  +A P+   L   + +ER  IL    + + ++
Sbjct: 53 IDAANRALPAWRAL---TAKERATILRNWFNLMMEH 85


>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic
           vesicle, membrane, Ca structural protein; 7.94A {Bos
           taurus}
          Length = 190

 Score = 25.3 bits (54), Expect = 3.9
 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 5   VSRNREFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEK 53
           +++  E I  WR E+   ++ L  A   M        E R+    DLE+
Sbjct: 80  LTQEPESIRKWREEQRKRLQELDAASKVMEQ------EWREKAKKDLEE 122


>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious
          disease, ssgcid; 2.70A {Burkholderia pseudomallei
          1710B} PDB: 3ifh_Q
          Length = 484

 Score = 24.7 bits (53), Expect = 4.9
 Identities = 10/36 (27%), Positives = 15/36 (41%), Gaps = 7/36 (19%)

Query: 23 VEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54
          +EA + A          + +ER AIL    D +  N
Sbjct: 56 IEAAQAAWAGWRMK---TAKERAAILRRWFDLVIAN 88


>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding,
           hydrolase; 2.86A {Staphylococcus hyicus}
          Length = 431

 Score = 24.7 bits (53), Expect = 5.4
 Identities = 13/57 (22%), Positives = 20/57 (35%), Gaps = 13/57 (22%)

Query: 12  IEYWRLERNSIVEALRK--------AKPSMSDLAMLSVEERDAILDDLEKNGSSDYS 60
             YW   + ++   LRK        +  +++     S  ER   L    K G  DY 
Sbjct: 73  ENYWGGTKANLRNHLRKAGYETYEASVSALA-----SNHERAVELYYYLKGGRVDYG 124


>2wfd_A Leucyl-tRNA synthetase, cytoplasmic; aminoacyl-tRNA synthetase,
           phosphoprotein, editing domain, nucleotide-binding,
           hydrolysis of MIS-charged trnas; 3.25A {Homo sapiens}
          Length = 252

 Score = 24.1 bits (51), Expect = 7.2
 Identities = 3/23 (13%), Positives = 7/23 (30%), Gaps = 1/23 (4%)

Query: 34  SDLAMLSVEE-RDAILDDLEKNG 55
                  V++ +  I   +   G
Sbjct: 223 DGFKGQKVQDVKKTIQKKMIDAG 245


>2l1n_A Uncharacterized protein; DUF1823, hypothetical protein,
          cyanobacteria, structural GEN PSI-2, protein structure
          initiative; NMR {Synechococcus elongatus}
          Length = 120

 Score = 24.1 bits (52), Expect = 7.4
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 39 LSVEERDAILDDLEKNGSSDYSFVNDL-WERLKYLRDLPVYNFSLDYVS 86
          ++ E   AIL D      SD +  N L W+ L Y+ D     +  D V+
Sbjct: 5  ITDELLWAILKD----ELSD-AEANALVWQALGYVWDEAQSCWKTDLVA 48


>2ajg_A Leucyl-tRNA synthetase; editing domain, ligase; 2.00A {Escherichia
           coli} PDB: 2ajh_A 2aji_A
          Length = 196

 Score = 23.7 bits (50), Expect = 9.8
 Identities = 7/18 (38%), Positives = 8/18 (44%), Gaps = 1/18 (5%)

Query: 39  LSVEE-RDAILDDLEKNG 55
           L  E   +AI D L   G
Sbjct: 173 LDHEAAFNAIADKLTAMG 190


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0496    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 976,346
Number of extensions: 41769
Number of successful extensions: 261
Number of sequences better than 10.0: 1
Number of HSP's gapped: 261
Number of HSP's successfully gapped: 51
Length of query: 108
Length of database: 5,693,230
Length adjustment: 72
Effective length of query: 36
Effective length of database: 3,947,662
Effective search space: 142115832
Effective search space used: 142115832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.6 bits)