RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 32.4 bits (73), Expect = 0.032 Identities = 15/138 (10%), Positives = 42/138 (30%), Gaps = 27/138 (19%) Query: 4 LSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVAR-VVGP------HIPNSN 56 L+ + Q+ +V + + +F + K A+ V+G + Sbjct: 195 LAPSRELARQIMDVVTEMGKYTEVKTAFGIKDSVPKGAKIDAQIVIGTPGTVMDLMKRRQ 254 Query: 57 VFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPK 116 + + ++ E ++++ I L + + + F A + + Sbjct: 255 LDARDIKVFVLDEADNMLDQQGLG-DQSMRI---------KHLLPRNTQIVLFS-ATFSE 303 Query: 117 KV---------GPSVIDV 125 +V + I + Sbjct: 304 RVEKYAERFAPNANEIRL 321 >3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A (A:) Length = 308 Score = 24.6 bits (52), Expect = 6.0 Identities = 4/41 (9%), Positives = 9/41 (21%), Gaps = 5/41 (12%) Query: 70 RGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFY 110 ++ Q + L D + +Y Sbjct: 273 CRKGMDVCGTSHQ-----QTPHDLYKNEEDPIHFAKIAGYY 308 >3bwx_A Alpha/beta hydrolase; YP_496220.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Novosphingobium aromaticivorans DSM12444} (A:151-208) Length = 58 Score = 24.3 bits (53), Expect = 7.5 Identities = 4/22 (18%), Positives = 8/22 (36%) Query: 30 SFADVHEALERYKKVARVVGPH 51 +F A ++ + V P Sbjct: 1 NFETWXHAARALQESSGDVYPD 22 >1u1j_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; methionine, synthase, methyltetrahydrofolate; HET: C2F; 2.40A {Arabidopsis thaliana} (A:430-487,A:682-765) Length = 142 Score = 24.3 bits (53), Expect = 8.5 Identities = 7/24 (29%), Positives = 10/24 (41%) Query: 106 SMSFYFAKYPKKVGPSVIDVVYPH 129 + KY +GP V D+ P Sbjct: 58 VVFREGVKYGAGIGPGVYDIHSPR 81 >2nwu_A UPF0201 protein SSO1042; conserved hypothetical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Sulfolobus solfataricus P2} (A:) Length = 155 Score = 24.3 bits (53), Expect = 8.9 Identities = 19/121 (15%), Positives = 38/121 (31%), Gaps = 22/121 (18%) Query: 32 ADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFE 91 A+V E KV + SN F + + II+ L + + ++S+ F Sbjct: 10 AEVR-PSEDVNKVLSAI------SNFFDFEKXN---TRKEGIIDILVLEARTLKSLLKFH 59 Query: 92 YLKTRLSDLEAHRRSM-------SFYF-----AKYPKKVGPSVIDVVYPHSHLVKEDKVD 139 + L++ R+ + + F A + D P + + Sbjct: 60 RVLRNERILDSARKYLXKGIEGNTIAFXIHKQAAAVGVLSFVDSDKESPLGAIKFYIEYQ 119 Query: 140 E 140 Sbjct: 120 N 120 >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein structure initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} (A:) Length = 177 Score = 24.0 bits (51), Expect = 9.7 Identities = 3/31 (9%), Positives = 9/31 (29%) Query: 18 VFCFVSHFVQRKSFADVHEALERYKKVARVV 48 + V+ K E ++ + + Sbjct: 25 FWLSVNRIYPEKRIELQLEVFKKLQDEKLYI 55 >2w19_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AROG; transferase isomerase complex, aromatic amino acid biosynthesis, multi-enzyme complex; 2.15A {Mycobacterium tuberculosis} PDB: 2w1a_A* 2b7o_A* (A:) Length = 472 Score = 24.0 bits (52), Expect = 9.9 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Query: 43 KVARVVGPHI-PNSNVFSSSVRRTYWSERGDIINALDQD 80 KVAR+ G + P S + S RGD+IN D Sbjct: 133 KVARIAGQYAKPRSADIDA---LGLRSYRGDMINGFAPD 168 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.133 0.386 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,189,725 Number of extensions: 49048 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's gapped: 112 Number of HSP's successfully gapped: 9 Length of query: 160 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 78 Effective length of database: 2,184,039 Effective search space: 170355042 Effective search space used: 170355042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.0 bits)