BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] (160 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 328 bits (840), Expect = 4e-92, Method: Compositional matrix adjust. Identities = 160/160 (100%), Positives = 160/160 (100%) Query: 1 MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSS 60 MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSS Sbjct: 1 MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSS 60 Query: 61 SVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGP 120 SVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGP Sbjct: 61 SVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGP 120 Query: 121 SVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP 160 SVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP Sbjct: 121 SVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP 160 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 26.2 bits (56), Expect = 0.33, Method: Composition-based stats. Identities = 37/149 (24%), Positives = 55/149 (36%), Gaps = 43/149 (28%) Query: 11 LVQVSILVFCFVSHFVQR-KSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRR----- 64 L + + + V FV R KS + EA+ +KK+ V + + N +SSV R Sbjct: 33 LRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIV 92 Query: 65 -------------------------TYWSERGDIINALDQDLQDVESIEVFEYLKTRLSD 99 + ER D + A+ Q L D V + Sbjct: 93 DIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPV---------E 143 Query: 100 LEAHRRSMSFYFAKY---PKKVGPSVIDV 125 LEA RS+ F+ Y KK+ P VI + Sbjct: 144 LEALSRSVIAEFSNYIKLNKKISPEVIGI 172 >gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 25.0 bits (53), Expect = 0.64, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 25/46 (54%) Query: 14 VSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFS 59 V IL+ F S + ++ + + A+ R + R+VG + N ++FS Sbjct: 303 VIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFS 348 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 23.5 bits (49), Expect = 1.8, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 29/69 (42%) Query: 22 VSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDL 81 V + R DV+E ++Y G I + +F SS +RT IN L + + Sbjct: 164 VGEYAVRGGILDVYEPTKKYPVRLDFFGNTIDSLRLFDSSTQRTIREISIFEINTLSEVM 223 Query: 82 QDVESIEVF 90 ++I F Sbjct: 224 LTSQNISRF 232 Score = 21.9 bits (45), Expect = 5.8, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 26/52 (50%) Query: 42 KKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYL 93 K+ V P + + +++S ++R E D A+D +QD+ S + + L Sbjct: 599 KRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRL 650 >gi|254781175|ref|YP_003065588.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Candidatus Liberibacter asiaticus str. psy62] Length = 296 Score = 22.7 bits (47), Expect = 3.4, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 38 LERYKKVARVVGPHIPNSNVFS 59 +ERY+K +G + NS V S Sbjct: 202 VERYRKAGCALGASLENSVVIS 223 >gi|254781084|ref|YP_003065497.1| hypothetical protein CLIBASIA_04930 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 21.2 bits (43), Expect = 9.0, Method: Compositional matrix adjust. Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 149 VDLNKLNAPGS 159 DLNK+NAP S Sbjct: 46 ADLNKMNAPDS 56 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.133 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,142 Number of Sequences: 1233 Number of extensions: 4051 Number of successful extensions: 12 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 9 length of query: 160 length of database: 328,796 effective HSP length: 67 effective length of query: 93 effective length of database: 246,185 effective search space: 22895205 effective search space used: 22895205 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)