RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|38235 KOG3025, KOG3025, KOG3025, Mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid [Energy production and conversion]. Length = 137 Score = 35.5 bits (81), Expect = 0.003 Identities = 20/72 (27%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 TAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLF 125 Query: 80 LLLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 CLMVAFLILFAM 137 >gnl|CDD|164765 MTH00222, ATP9, ATP synthase F0 subunit 9; Provisional. Length = 77 Score = 33.3 bits (76), Expect = 0.017 Identities = 22/69 (31%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 7 AAKFVGAGAATIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 66 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 67 LMMAFLILF 75 >gnl|CDD|110122 pfam01098, FTSW_RODA_SPOVE, Cell cycle protein. This entry includes the following members; FtsW, RodA, SpoVE. Length = 356 Score = 28.4 bits (64), Expect = 0.40 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 IFAVI E LG L+++ L F++ Sbjct: 255 IFAVIGEELGFIGALLLLALFFLL 278 >gnl|CDD|30981 COG0636, AtpE, F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Energy production and conversion]. Length = 79 Score = 28.3 bits (63), Expect = 0.55 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 AA +L +AVG+A LG + I + R P AA ++ I Sbjct: 1 MTAAKKGLALIGAGLAVGLAALG---AGIGQGIIGAAAVEAVARQPEAAGKLFGKMFIGL 57 Query: 71 VIAESLGLFLLLVVMLLLFVI 91 + E+LG++ L++ +LLLF Sbjct: 58 ALVEALGIYGLVIALLLLFAN 78 >gnl|CDD|144575 pfam01034, Syndecan, Syndecan domain. Syndecans are transmembrane heparin sulfate proteoglycans which are implicated in the binding of extracellular matrix components and growth factors. Length = 207 Score = 27.8 bits (62), Expect = 0.59 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Query: 62 HKTEVLIFAVIAESL-G-LFLLLVVMLLLF 89 + EVL AVIA + G LF + +VM L++ Sbjct: 148 ERKEVLA-AVIAGGVVGLLFAVFLVMFLVY 176 >gnl|CDD|35847 KOG0628, KOG0628, KOG0628, Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism]. Length = 511 Score = 26.8 bits (59), Expect = 1.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 9 ATFAAANGYYSLAAKYVAVGMACLG 33 A F A N Y S+ A ++ G+ C+G Sbjct: 78 AYFPAGNSYPSILADMLSGGIGCVG 102 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 25.7 bits (56), Expect = 2.8 Identities = 20/74 (27%), Positives = 37/74 (50%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 ++G Y L++ Y+A +A L LV + + ++ G +L+ +++A Sbjct: 424 SSGLYRLSSYYLAKTLAELPFLLVLSIIFSSIVYWMVGLNPGLSRFLYFLLIILLSSLVA 483 Query: 74 ESLGLFLLLVVMLL 87 ESLGLF+ +V L Sbjct: 484 ESLGLFISAIVPNL 497 >gnl|CDD|31115 COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning]. Length = 381 Score = 25.6 bits (56), Expect = 3.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 IFAVI E G L ++ L F++ Sbjct: 273 IFAVIGEEFGFIGALFLLALFFLL 296 >gnl|CDD|143909 pfam00137, ATP-synt_C, ATP synthase subunit C. Length = 66 Score = 24.7 bits (55), Expect = 5.8 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 + G+A L + + + RNP ++LI A +AE+L ++ Sbjct: 1 LAALGAGLAIGLAALGAGIGIGIAGAAAIEAIARNP----ELFGKMLIGAALAEALAIYG 56 Query: 81 LLVVMLLLFV 90 L++ +LLLF Sbjct: 57 LVIALLLLFA 66 >gnl|CDD|30292 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues.. Length = 210 Score = 24.8 bits (54), Expect = 5.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASA 61 VA+ S+ F Y G + PC ++ Sbjct: 132 VAIDASSSFQFYKGGIYSGPCCSNT 156 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.330 0.138 0.387 Gapped Lambda K H 0.267 0.0798 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 971,837 Number of extensions: 44190 Number of successful extensions: 321 Number of sequences better than 10.0: 1 Number of HSP's gapped: 319 Number of HSP's successfully gapped: 50 Length of query: 91 Length of database: 6,263,737 Length adjustment: 60 Effective length of query: 31 Effective length of database: 4,967,197 Effective search space: 153983107 Effective search space used: 153983107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (23.3 bits)