RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|181027 PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated. Length = 74 Score = 61.1 bits (149), Expect = 6e-11 Identities = 36/70 (51%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K++ G+AC+GM AL V NIF YLSGA RNP AA + +LI A +AE+LG+F Sbjct: 5 ALKFIGAGLACIGMAGAALGVGNIFGNYLSGALRNPSAADSQFGYLLIGAALAEALGIFS 64 Query: 81 LLVVMLLLFV 90 L+ +LLLF Sbjct: 65 FLIALLLLFA 74 >gnl|CDD|162950 TIGR02614, ftsW, cell division protein FtsW. This family consists of FtsW, an integral membrane protein with ten transmembrane segments. In general, it is one of two paralogs involved in peptidoglycan biosynthesis, the other being RodA, and is essential for cell division. All members of the seed alignment for this model are encoded in operons for the biosynthesis of UDP-N-acetylmuramoyl-pentapeptide, a precursor of murein (peptidoglycan). The FtsW designation is not used in endospore-forming bacterial (e.g. Bacillus subtilis), where the member of this family is designated SpoVE and three or more RodA/FtsW/SpoVE family paralogs are present. SpoVE acts in spore cortex formation and is dispensible for growth. Biological rolls for FtsW in cell division include recruitment of penicillin-binding protein 3 to the division site. Length = 356 Score = 28.7 bits (65), Expect = 0.31 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 IFAVI E LG +L+V+LL + Sbjct: 257 IFAVIGEELGFIGVLIVILLFAFL 280 >gnl|CDD|168839 PRK07159, PRK07159, F0F1 ATP synthase subunit C; Validated. Length = 100 Score = 28.7 bits (64), Expect = 0.32 Identities = 23/77 (29%), Positives = 36/77 (46%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 A L A Y+ G+A +G+ V L F + RNP A + I + I+ Sbjct: 23 AADSSGLKAAYIGAGLAMIGVIGVGLGQGYAFGKAVEAIARNPEAQKQVFKLLFIGSAIS 82 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ ++ LLV +L+FV Sbjct: 83 ETSSIYALLVAFILIFV 99 >gnl|CDD|140227 PTZ00200, PTZ00200, cysteine proteinase; Provisional. Length = 448 Score = 28.5 bits (64), Expect = 0.39 Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAAS 60 +V +AVS Y SG + C S Sbjct: 361 VVYIAVSRELLKYKSGVYNGECGKS 385 >gnl|CDD|184069 PRK13471, PRK13471, F0F1 ATP synthase subunit C; Provisional. Length = 85 Score = 26.8 bits (59), Expect = 1.2 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVS--NIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 L KY+ G+ C+G+G + + NI + R P T +L+ +AE+ G Sbjct: 13 LLGKYIGAGL-CMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITTRMLLADAVAETTG 71 Query: 78 LFLLLVVMLLLFVI 91 ++ LL+ L+L V+ Sbjct: 72 IYSLLIAFLILLVL 85 >gnl|CDD|182737 PRK10794, PRK10794, cell wall shape-determining protein; Provisional. Length = 370 Score = 26.6 bits (59), Expect = 1.6 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Query: 68 IFAVIAESLGLF-LLLVVMLLLFVI 91 IFAV+AE LGL +L+++ L + +I Sbjct: 264 IFAVLAEELGLVGVLILLALYILLI 288 >gnl|CDD|162763 TIGR02210, rodA_shape, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. Length = 352 Score = 25.2 bits (56), Expect = 4.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 IF+V+AE G LV++LL ++ Sbjct: 252 IFSVLAEEFGFVGGLVLLLLYLLL 275 >gnl|CDD|182719 PRK10774, PRK10774, cell division protein FtsW; Provisional. Length = 404 Score = 24.7 bits (54), Expect = 5.8 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 IF++I E LG +++ +L++F + Sbjct: 289 IFSIIGEELGYIGVVLALLMVFFV 312 >gnl|CDD|184357 PRK13873, PRK13873, conjugal transfer ATPase TrbE; Provisional. Length = 811 Score = 24.1 bits (53), Expect = 7.5 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 15/43 (34%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 LG+G VALA CAAS+ + LI V+AE Sbjct: 749 LGLGPVALAF---------------CAASSKADQALIDRVLAE 776 >gnl|CDD|130622 TIGR01559, squal_synth, farnesyl-diphosphate farnesyltransferase. This model describes farnesyl-diphosphate farnesyltransferase, also known as squalene synthase, as found in eukaryotes. This family is related to phytoene synthases. Tentatively identified archaeal homologs (excluded from this model) lack the C-terminal predicted transmembrane region universally conserved among members of this family. Length = 336 Score = 23.9 bits (52), Expect = 9.4 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 19/63 (30%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 Y YVA GLV + +S +F ++ F +P S ++E ++ S+G Sbjct: 134 YDKYCHYVA--------GLVGIGLSRLF---VASGFEDP---SLGESEA-----LSNSMG 174 Query: 78 LFL 80 LFL Sbjct: 175 LFL 177 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.330 0.138 0.387 Gapped Lambda K H 0.267 0.0834 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,408,114 Number of extensions: 78009 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's gapped: 365 Number of HSP's successfully gapped: 60 Length of query: 91 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 32 Effective length of database: 4,719,601 Effective search space: 151027232 Effective search space used: 151027232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (22.8 bits)