RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >2wgm_A ATP synthase subunit C, sodium ION specific; F1FO-ATP synthase rotor, sodium-motive force, cell inner membrane, CF(0), membrane, transport; HET: F09; 2.35A {Ilyobacter tartaricus} PDB: 1yce_A* (A:) Length = 89 Score = 38.1 bits (89), Expect = 4e-04 Identities = 16/71 (22%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA V G A + + + R P A + +++ +AES G++ Sbjct: 11 LAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIY 70 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 71 SLVIALILLYA 81 >1wu0_A ATP synthase C chain; ATPase, membrane protein, hydrogen ION transport, hydrolase; NMR {Bacillus SP} (A:) Length = 72 Score = 33.7 bits (78), Expect = 0.009 Identities = 13/71 (18%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 20 LAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++ +A +A LG + I + + G R P +T + I + E+L + Sbjct: 1 MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPI 60 Query: 79 FLLLVVMLLLF 89 ++ + L Sbjct: 61 IGVVFSFIYLG 71 >2wie_A C15_RING, ATP synthase C chain; hydrolase, F1FO ATP synthase rotor, ION proton-translocation, ION transport, transmembrane; HET: FME CVM; 2.13A {Arthrospira platensis} PDB: 2w5j_A (A:) Length = 82 Score = 30.7 bits (70), Expect = 0.068 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AA +A +A +G L + G R P A + +L+ E+L + Sbjct: 7 TAASVIAAALAVGIGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTI 66 Query: 79 FLLLVVMLLLFV 90 + L+V ++LLF Sbjct: 67 YGLVVALVLLFA 78 >1a91_A F1FO ATPase subunit C; membrane protein, hydrogen ION transport; NMR {Escherichia coli} (A:) Length = 79 Score = 28.3 bits (64), Expect = 0.36 Identities = 12/73 (16%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Query: 20 LAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 + Y+A + L A+ + + +L GA R P +T+ I + +++ + Sbjct: 6 MDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPM 65 Query: 79 FLLLVVMLLLFVI 91 + + + ++F + Sbjct: 66 IAVGLGLYVMFAV 78 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.330 0.138 0.387 Gapped Lambda K H 0.267 0.0770 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 573,828 Number of extensions: 18915 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 5 Length of query: 91 Length of database: 4,956,049 Length adjustment: 52 Effective length of query: 39 Effective length of database: 3,198,189 Effective search space: 124729371 Effective search space used: 124729371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.0 bits)