BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] (91 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 178 bits (451), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 91/91 (100%), Positives = 91/91 (100%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS Sbjct: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 Query: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI Sbjct: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 >537021.9.peg.1083_1 Length = 40 Score = 24.3 bits (51), Expect = 0.47, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 51 GAFRNPCAASAHKTEVLI 68 F+NPC S TEV + Sbjct: 23 DVFKNPCDVSKKLTEVFL 40 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.330 0.138 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,492 Number of Sequences: 1233 Number of extensions: 1371 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 91 length of database: 328,796 effective HSP length: 59 effective length of query: 32 effective length of database: 256,049 effective search space: 8193568 effective search space used: 8193568 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 31 (16.5 bits)