HHsearch alignment for GI: 254781088 and conserved domain: MTH00087

>MTH00087 ATP6 ATP synthase F0 subunit 6; Provisional.
Probab=100.00  E-value=0  Score=259.10  Aligned_cols=185  Identities=25%  Similarity=0.405  Sum_probs=152.5

Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCHHH
Q ss_conf             99999831465537886403567788756787752057667530258999999851232323012454431035542146
Q gi|254781088|r   41 FIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF  120 (250)
Q Consensus        41 ~~~~~~~~~~~~~vP~~~q~~~E~i~~~i~~~v~~~~g~~~~~~~p~i~TlF~fIl~~NllGLiP~~~~~Ta~l~~t~~l  120 (250)
T Consensus        10 fl~~~~l~~~~w~~~s~~~~l~~~~~~~l~~~f~~~--~k~~~~~~i~~~~F~fil~~N~~GL~Py~Ft~tshl~~tl~l   87 (194)
T MTH00087         10 FMFFFLLQFLFYFKLSMLNVLVKKFFSLLVLVFSFS--NKLPLSSVISEFTFIVLLMCNFGGLFPYFFSPCGYVEFNFLY   87 (194)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHH
T ss_conf             999999999999988799999999999999999999--836327999999999999999885158877968789999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79999999999984158642111389999875430233356776544133333577787776899999999999999987
Q gi|254781088|r  121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSI  200 (250)
Q Consensus       121 al~~~~~~~~~g~~~~g~~~~~~~~~~g~p~~l~p~~~~iE~is~~~rp~sLs~RLfgNi~aG~iil~l~~~~~~~~~~~  200 (250)
T Consensus        88 al~~Wl~~~~~~~~~--~~~~~hl~P~GtP~~L~p~mv~IE~iS~~iRP~tLsvRL~ANm~AGHll~~ll~~~~~~----  161 (194)
T MTH00087         88 AFVAWMSTFLSFLSS--EKFSSHMLPDGSPFFLWFFMLFVEIVSELSRPLALTLRLTCNLLVGHVMSSLILSLGFK----  161 (194)
T ss_pred             HHHHHHHHHHHHHHH--HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
T ss_conf             999999999999920--26787757899807899999999999999819999999999998889999999999999----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8899999999999999999999999999999999999999733
Q gi|254781088|r  201 GMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGD  243 (250)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~lel~v~~iQAyVF~~Lt~~Yi~~  243 (250)
T Consensus       162 ----------~~~~~~~~~~lE~~Va~IQaYVFs~L~~lYl~E  194 (194)
T MTH00087        162 ----------YLFLSILAIMFECFVAFIQSYIFSLLIYLYLNE  194 (194)
T ss_pred             ----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             ----------999999999999999999999999999998089