BLAST/PSIBLAST alignment of GI: 254781088 and GI: 227821026 at iteration 1
>gi|227821026|ref|YP_002824996.1| F0F1 ATP synthase subunit A [Sinorhizobium fredii NGR234] Length = 250
>gi|254807657|sp|C3MHB5|ATP6_RHISN RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 250
>gi|227340025|gb|ACP24243.1| ATP synthase A chain [Sinorhizobium fredii NGR234] Length = 250
 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 132/250 (52%), Positives = 176/250 (70%)

Query: 1   MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60
           MS  P  QF+V KIVPI++ G D SFTN+SL M+ ++ V   F +   S   V+PTR+QS
Sbjct: 1   MSNDPTHQFLVNKIVPIEIGGIDFSFTNASLFMVATVGVAAGFLYLTTSQRGVIPTRMQS 60

Query: 61  FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120
             E+ Y+FI S L + AG+    FFP VFSLF+F+ TANLLG+ PY F+ TSQI+VT + 
Sbjct: 61  VSEVSYEFIASMLREGAGSHGMKFFPMVFSLFMFILTANLLGMFPYFFTVTSQIIVTFAL 120

Query: 121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
           ++ V+ +V++ GFY +G GFL+LF+P  +P  + PLV  IEV SFL RP+SLS+RLFANM
Sbjct: 121 AVFVIGTVILYGFYKHGFGFLKLFVPHGVPGALLPLVVSIEVISFLSRPISLSVRLFANM 180

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
           LAGH+ LKVFAGF  S+ + G LGI  + LP++  VA+TGLEF VAF+QAY+F VL C+Y
Sbjct: 181 LAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY 240

Query: 241 IGDVYRSDQH 250
           + D      H
Sbjct: 241 LNDAVHPGSH 250