RPSBLAST alignment for GI: 254781088 and conserved domain: MTH00176

>gnl|CDD|177229 MTH00176, ATP6, ATP synthase F0 subunit 6; Provisional. Length = 229
 Score = 95.5 bits (238), Expect = 1e-20
 Identities = 65/224 (29%), Positives = 114/224 (50%), Gaps = 3/224 (1%)

Query: 22  FDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQS 81
           FD    N    + +S + + +F     S+    P++LQ F  +   F+   +  S G+  
Sbjct: 9   FDPPNKNIFSMISLSWITLLLFLLLMPSSVWFCPSKLQVFMLMFSTFLPEMILRSNGSYI 68

Query: 82  KNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFL 141
                 + SLF+ + + NL GL PY+F+ TS +V+T S +L + L V++SGF  N    L
Sbjct: 69  LGSASIIISLFILVMSLNLSGLIPYVFTSTSHLVITLSLALPLWLGVILSGFINNFYSRL 128

Query: 142 RLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIG 201
              +P+  P L+ P +  IE+ S L RP++L++RL AN+ AGHL+L +       ++ + 
Sbjct: 129 SHLVPQGTPPLLNPFLVLIELVSLLIRPLTLAVRLAANLSAGHLLLGLLGAAMWGLLPVS 188

Query: 202 MLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVY 245
              +    L ++  +     E  V  +QAY+F +L  +Y+ +  
Sbjct: 189 --PLIGFLLLIVQ-ILYFMFEIAVCMIQAYVFTLLLSLYLDEHP 229