RPSBLAST alignment for GI: 254781088 and conserved domain: MTH00179

>gnl|CDD|177230 MTH00179, ATP6, ATP synthase F0 subunit 6; Provisional. Length = 227
 Score = 83.8 bits (208), Expect = 4e-17
 Identities = 61/208 (29%), Positives = 103/208 (49%), Gaps = 5/208 (2%)

Query: 34  LVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFV 93
           L++L ++  +  F     R +  RL +     +      L      +   +     SL +
Sbjct: 19  LLALALLLPWLLFPSLTNRWLNNRLSTLQSWFFGSFTFQLMQPINKKGHKWAVLFLSLML 78

Query: 94  FLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLI 153
           FL T NLLGL PY F+ T+Q+ +    +L + L  V+ G +      L   +P+  P  +
Sbjct: 79  FLLTLNLLGLLPYTFTPTTQLSLNLGLALPLWLGTVLYGLFNQPTIALAHLLPEGTPTPL 138

Query: 154 KPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFA-GFSTSMMSIGMLGIAFSFLPV 212
            P++ +IE  S L RP++L +RL AN+ AGHL++ + +      M  +GM+      L +
Sbjct: 139 IPMLVWIETISLLIRPLALGVRLTANITAGHLLMHLISSAVFVLMNFMGMVA----LLTL 194

Query: 213 LANVAVTGLEFFVAFMQAYIFMVLACVY 240
           L    +T LE  VA +QAY+F++L  +Y
Sbjct: 195 LVLFLLTLLEVAVAMIQAYVFVLLLSLY 222