RPSBLAST alignment for GI: 254781088 and conserved domain: PRK13421

>gnl|CDD|184045 PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional. Length = 223
 Score = 72.4 bits (178), Expect = 1e-13
 Identities = 62/251 (24%), Positives = 111/251 (44%), Gaps = 30/251 (11%)

Query: 1   MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60
           M+ SP+S   +  + P+ +       +   +     + V+   +  A     + P RLQS
Sbjct: 1   MTASPLSTVPLFSLGPVPI-------SAPVVVTWAIMAVLAAGSALATRRLSLAPGRLQS 53

Query: 61  FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120
             E++   I + + D+       +   + +LF+F+  AN   L P +   T+ +    + 
Sbjct: 54  VLELVVTTIDAQIRDTMQTDPAPYRALIGTLFLFVLVANWSSLVPGVEPPTAHLETDAAL 113

Query: 121 SLLVVLSVVISGFYVNGL-GFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFAN 179
           +L+V L+ +  G    G+ G+L  F  +   ++I PL     +   L R  SL +RLF N
Sbjct: 114 ALIVFLATIYYGVRARGVRGYLATFA-EPTWVMI-PL----NLVEQLTRTFSLIVRLFGN 167

Query: 180 MLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACV 239
           +++G     VF           ++GI  S   +L  + +  L+     +QAYIF VLA V
Sbjct: 168 VMSG-----VF-----------VIGIVLSLAGLLVPIPLMALDLLTGAVQAYIFAVLAMV 211

Query: 240 YIGDVYRSDQH 250
           +IG     D+ 
Sbjct: 212 FIGAAVSDDEA 222