RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781088|ref|YP_003065501.1| F0F1 ATP synthase subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (250 letters)



>d1c17m_ f.18.1.1 (M:) F1F0 ATP synthase subunit A {Escherichia coli
           [TaxId: 562]}
          Length = 171

 Score = 72.6 bits (178), Expect = 3e-14
 Identities = 47/181 (25%), Positives = 74/181 (40%), Gaps = 30/181 (16%)

Query: 79  NQSKNFFPFVFSLFVFLTTANLLGLHPYLF----------------SFTSQIVVTTSFSL 122
            +SK   P   ++FV++   NL+ L P                     ++ + VT S +L
Sbjct: 2   GKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMAL 61

Query: 123 LVVLSVVISGFYVNGLGF--LRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
            V + ++     + G+G     L +         P+   +E  S L +PVSL LRLF NM
Sbjct: 62  GVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNM 121

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
            AG L+  + AG                +   + NV        +  +QA+IFMVL  VY
Sbjct: 122 YAGELIFILIAGL------------LPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVY 169

Query: 241 I 241
           +
Sbjct: 170 L 170


>d1hk8a_ c.7.1.3 (A:) Class III anaerobic ribonucleotide reductase
           NRDD subunit {Bacteriophage T4 [TaxId: 10665]}
          Length = 561

 Score = 26.0 bits (57), Expect = 3.2
 Identities = 7/39 (17%), Positives = 11/39 (28%)

Query: 55  PTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFV 93
           P  +     I+ Q          G  +      V S +V
Sbjct: 77  PKSIGVATAIMAQITAQVASHQYGGTTFANVDKVLSPYV 115


>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId:
           9606]}
          Length = 142

 Score = 25.5 bits (56), Expect = 4.3
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 4/68 (5%)

Query: 59  QSFFEIIY---QFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIV 115
           ++ FEI      F    L  S   +   F  + F  F   TT  + GLHP  ++FTSQ +
Sbjct: 9   ENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHP-EYNFTSQYL 67

Query: 116 VTTSFSLL 123
           V  +   L
Sbjct: 68  VHVNDLFL 75


>d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase
           {Azotobacter vinelandii [TaxId: 354]}
          Length = 740

 Score = 24.7 bits (54), Expect = 7.5
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 1   MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIF 41
           MSK+ +  FI  +I   + QG  LS    +  M VS  ++F
Sbjct: 226 MSKNALRNFIAAEIEDAKKQGVLLSVHLKATMMKVSDPIMF 266


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.336    0.145    0.426 

Gapped
Lambda     K      H
   0.267   0.0671    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 853,214
Number of extensions: 36693
Number of successful extensions: 95
Number of sequences better than 10.0: 1
Number of HSP's gapped: 93
Number of HSP's successfully gapped: 7
Length of query: 250
Length of database: 2,407,596
Length adjustment: 83
Effective length of query: 167
Effective length of database: 1,268,006
Effective search space: 211757002
Effective search space used: 211757002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 52 (23.9 bits)