Query         gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 80
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 00:21:50 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781089.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1xjc_A MOBB protein homolog; s  81.0    0.43 1.8E-05   26.1   1.2   16    1-16     10-25  (169)
  2 1np6_A Molybdopterin-guanine d  76.4    0.85 3.6E-05   24.5   1.6   16    2-17     13-28  (174)
  3 1e69_A Chromosome segregation   69.6     1.4 5.8E-05   23.4   1.3   20    2-21     31-51  (322)
  4 1w1w_A Structural maintenance   68.9     1.8 7.6E-05   22.7   1.8   19    2-20     33-52  (430)
  5 1ii8_A RAD50 ABC-ATPase; MRE11  66.8     2.3 9.8E-05   22.2   2.0   19    2-20     30-50  (195)
  6 1qhl_A Protein (cell division   63.4     2.2 9.4E-05   22.3   1.4   16    2-17     34-49  (227)
  7 2gks_A Bifunctional SAT/APS ki  63.4     3.8 0.00016   21.0   2.5   37    1-43    378-414 (546)
  8 2f1r_A Molybdopterin-guanine d  61.7     1.4 5.8E-05   23.4   0.0   16    1-16      8-23  (171)
  9 2o5v_A DNA replication and rep  59.2      11 0.00046   18.6   5.7   17    2-18     33-49  (359)
 10 1f2t_A RAD50 ABC-ATPase; DNA d  58.6     3.8 0.00016   21.0   1.9   19    2-20     30-50  (149)
 11 3cr8_A Sulfate adenylyltranfer  55.6     3.9 0.00016   21.0   1.5   16    1-16    375-390 (552)
 12 2yyz_A Sugar ABC transporter,   53.2     3.9 0.00017   20.9   1.2   18    1-18     35-52  (359)
 13 1g29_1 MALK, maltose transport  52.4     4.9  0.0002   20.5   1.6   18    1-18     35-52  (372)
 14 1m7g_A Adenylylsulfate kinase;  50.8     5.3 0.00022   20.2   1.6   16    1-16     31-46  (211)
 15 1l2t_A Hypothetical ABC transp  50.5     4.6 0.00019   20.6   1.2   16    1-16     37-52  (235)
 16 2it1_A 362AA long hypothetical  50.1     4.7  0.0002   20.5   1.2   17    1-17     35-51  (362)
 17 1v43_A Sugar-binding transport  49.9     4.8  0.0002   20.5   1.2   18    1-18     43-60  (372)
 18 2olj_A Amino acid ABC transpor  49.6     4.9  0.0002   20.5   1.2   18    1-18     56-73  (263)
 19 3kta_A Chromosome segregation   47.2     6.6 0.00028   19.7   1.6   21    2-22     33-55  (182)
 20 1yrb_A ATP(GTP)binding protein  46.8     6.7 0.00028   19.7   1.6   17    2-18     21-37  (262)
 21 1b0u_A Histidine permease; ABC  45.4     6.2 0.00026   19.9   1.2   17    1-17     38-54  (262)
 22 2pcj_A ABC transporter, lipopr  45.3     6.4 0.00027   19.8   1.3   18    1-18     36-53  (224)
 23 3fvq_A Fe(3+) IONS import ATP-  45.1     5.5 0.00023   20.2   0.9   17    1-17     36-52  (359)
 24 1z47_A CYSA, putative ABC-tran  44.6     6.5 0.00027   19.8   1.2   17    1-17     47-63  (355)
 25 3d31_A Sulfate/molybdate ABC t  43.6     5.2 0.00022   20.3   0.6   18    1-18     32-49  (348)
 26 1m8p_A Sulfate adenylyltransfe  43.4     8.7 0.00037   19.1   1.7   16    1-16    402-417 (573)
 27 2awn_A Maltose/maltodextrin im  43.1     7.1  0.0003   19.6   1.2   18    1-18     35-52  (381)
 28 1g7s_A Translation initiation   42.6     7.2  0.0003   19.5   1.2   17    1-17     11-27  (594)
 29 3dhw_C Methionine import ATP-b  42.2     6.5 0.00027   19.8   0.9   17    1-17     37-53  (343)
 30 3euj_A Chromosome partition pr  41.3      10 0.00044   18.7   1.9   20    2-21     36-57  (483)
 31 2d2e_A SUFC protein; ABC-ATPas  41.1     8.5 0.00036   19.2   1.4   17    1-17     35-51  (250)
 32 2cbz_A Multidrug resistance-as  40.0     8.4 0.00035   19.2   1.2   16    1-16     37-52  (237)
 33 1ltq_A Polynucleotide kinase;   39.4     9.3 0.00039   18.9   1.4   16    1-16      8-23  (301)
 34 2onk_A Molybdate/tungstate ABC  39.4     8.7 0.00037   19.1   1.2   18    1-18     30-47  (240)
 35 2hf9_A Probable hydrogenase ni  39.1     8.3 0.00035   19.2   1.1   16    1-16     44-59  (226)
 36 2bdt_A BH3686; alpha-beta prot  38.9     8.9 0.00038   19.0   1.2   32    1-42      8-39  (189)
 37 1oxx_K GLCV, glucose, ABC tran  38.9       6 0.00025   20.0   0.3   16    1-16     37-52  (353)
 38 1f6b_A SAR1; gtpases, N-termin  37.9     7.9 0.00033   19.3   0.8   19    1-20     31-49  (198)
 39 1mv5_A LMRA, multidrug resista  37.8     9.6  0.0004   18.9   1.2   20    1-20     34-53  (243)
 40 1knq_A Gluconate kinase; ALFA/  37.6     9.6 0.00041   18.9   1.2   15    1-15     14-28  (175)
 41 1ly1_A Polynucleotide kinase;   37.3      12 0.00049   18.4   1.6   16    1-16      8-23  (181)
 42 2ff7_A Alpha-hemolysin translo  36.9      10 0.00042   18.8   1.2   18    1-18     41-58  (247)
 43 2nq2_C Hypothetical ABC transp  36.7      10 0.00043   18.7   1.2   17    1-17     37-53  (253)
 44 2ged_A SR-beta, signal recogni  36.2      11 0.00047   18.5   1.4   16    1-16     54-69  (193)
 45 2yz2_A Putative ABC transporte  35.9      11 0.00045   18.6   1.2   16    1-16     39-54  (266)
 46 3gfo_A Cobalt import ATP-bindi  35.7      11 0.00045   18.6   1.2   16    1-16     40-55  (275)
 47 2ihy_A ABC transporter, ATP-bi  35.5      11 0.00046   18.6   1.2   17    1-17     53-69  (279)
 48 2pjz_A Hypothetical protein ST  34.6      12 0.00048   18.5   1.2   16    1-16     36-51  (263)
 49 2yvu_A Probable adenylyl-sulfa  34.5      12 0.00049   18.4   1.2   16    1-16     19-34  (186)
 50 1ye8_A Protein THEP1, hypothet  34.4      14 0.00058   18.0   1.6   15    2-16      7-21  (178)
 51 2pze_A Cystic fibrosis transme  34.3      12 0.00049   18.4   1.2   16    1-16     40-55  (229)
 52 2bbs_A Cystic fibrosis transme  34.3      10 0.00043   18.7   0.9   18    1-18     70-87  (290)
 53 2h5e_A Peptide chain release f  34.2      12 0.00051   18.3   1.2   22    2-23     20-41  (529)
 54 1g6h_A High-affinity branched-  34.0      11 0.00047   18.5   1.0   18    1-18     39-56  (257)
 55 2qt1_A Nicotinamide riboside k  33.6      13 0.00053   18.2   1.3   15    2-16     28-42  (207)
 56 1sgw_A Putative ABC transporte  33.5      12 0.00052   18.3   1.2   17    1-17     41-57  (214)
 57 1ii2_A Phosphoenolpyruvate car  33.1      11 0.00046   18.6   0.9   12    1-12    219-230 (524)
 58 2oap_1 GSPE-2, type II secreti  32.5      15 0.00063   17.9   1.5   17    2-18    267-283 (511)
 59 2jaq_A Deoxyguanosine kinase;   32.3      16 0.00066   17.7   1.6   15    2-16      7-21  (205)
 60 1ytm_A Phosphoenolpyruvate car  32.3      11 0.00048   18.5   0.9   12    1-12    241-252 (532)
 61 3gd7_A Fusion complex of cysti  32.3      14 0.00058   18.0   1.3   17    1-17     53-69  (390)
 62 2rhm_A Putative kinase; ZP_007  32.0      14 0.00059   18.0   1.3   14    2-15     12-25  (193)
 63 1zj6_A ADP-ribosylation factor  31.8      12 0.00051   18.4   0.9   16    1-16     22-37  (187)
 64 2qi9_C Vitamin B12 import ATP-  31.7      14 0.00058   18.0   1.2   38    1-46     32-69  (249)
 65 2ghi_A Transport protein; mult  31.7      14 0.00058   18.0   1.2   17    1-17     52-68  (260)
 66 2wsm_A Hydrogenase expression/  31.6      12 0.00051   18.3   0.9   16    1-16     36-51  (221)
 67 1qhx_A CPT, protein (chloramph  31.6      16 0.00069   17.6   1.6   15    1-15      9-23  (178)
 68 2www_A Methylmalonic aciduria   31.4      29  0.0012   16.3   2.8   33    2-34     81-116 (349)
 69 3a4m_A L-seryl-tRNA(SEC) kinas  31.0      14  0.0006   17.9   1.2   16    1-16     10-25  (260)
 70 1j3b_A ATP-dependent phosphoen  30.7     9.4 0.00039   18.9   0.2   12    1-12    231-242 (529)
 71 2fh5_B SR-beta, signal recogni  30.4      15 0.00062   17.9   1.2   16    1-16     13-28  (214)
 72 1m2o_B GTP binding, GTP-bindin  30.0      13 0.00056   18.1   0.9   15    1-15     29-43  (190)
 73 2olr_A Phosphoenolpyruvate car  30.0      13 0.00056   18.1   0.9   12    1-12    247-258 (540)
 74 2gza_A Type IV secretion syste  30.0      17 0.00072   17.5   1.4   17    2-18    182-198 (361)
 75 1nrj_B SR-beta, signal recogni  29.8      15 0.00065   17.8   1.2   16    1-16     18-33  (218)
 76 2zu0_C Probable ATP-dependent   29.8      17  0.0007   17.6   1.4   16    1-16     52-67  (267)
 77 1ji0_A ABC transporter; ATP bi  29.7      14 0.00061   17.9   1.0   18    1-18     38-55  (240)
 78 2wji_A Ferrous iron transport   29.6      17 0.00071   17.6   1.4   16    1-16      9-24  (165)
 79 2ixe_A Antigen peptide transpo  28.8      17 0.00069   17.6   1.2   18    1-18     51-68  (271)
 80 1kht_A Adenylate kinase; phosp  27.8      21 0.00087   17.1   1.6   15    2-16     10-24  (192)
 81 1svi_A GTP-binding protein YSX  27.8      17 0.00071   17.6   1.1   16    1-16     29-44  (195)
 82 1vpl_A ABC transporter, ATP-bi  27.7      18 0.00074   17.5   1.2   17    1-17     47-63  (256)
 83 1rz3_A Hypothetical protein rb  27.5      19 0.00078   17.3   1.3   16    2-17     29-44  (201)
 84 1zo1_I IF2, translation initia  26.7      16 0.00069   17.6   0.9   16    1-16     10-25  (501)
 85 1cip_A Protein (guanine nucleo  26.3      19 0.00082   17.2   1.2   32   10-41    241-274 (353)
 86 2wjg_A FEOB, ferrous iron tran  26.0      21 0.00089   17.0   1.4   16    1-16     13-28  (188)
 87 1zd9_A ADP-ribosylation factor  26.0      20 0.00083   17.2   1.2   16    1-16     28-43  (188)
 88 3ohm_A Guanine nucleotide-bind  25.6      20 0.00085   17.1   1.2   32   10-41    215-248 (327)
 89 3c8u_A Fructokinase; YP_612366  25.3      25   0.001   16.7   1.6   15    2-16     29-43  (208)
 90 3o47_A ADP-ribosylation factor  25.1      15 0.00062   17.9   0.4   15    1-15    171-185 (329)
 91 2pt7_A CAG-ALFA; ATPase, prote  24.7      20 0.00086   17.1   1.1   16    2-17    178-193 (330)
 92 1zp6_A Hypothetical protein AT  24.5      23 0.00096   16.9   1.3   15    1-15     15-29  (191)
 93 2p5s_A RAS and EF-hand domain   24.1      24   0.001   16.7   1.4   16    1-16     34-49  (199)
 94 3nh6_A ATP-binding cassette SU  24.0      21 0.00088   17.1   1.0   18    1-18     86-103 (306)
 95 1yqt_A RNAse L inhibitor; ATP-  23.0      26  0.0011   16.5   1.4   15    2-16     54-68  (538)
 96 2qu8_A Putative nucleolar GTP-  23.0      25   0.001   16.7   1.2   16    1-16     35-50  (228)
 97 2i3b_A HCR-ntpase, human cance  22.9      25  0.0011   16.7   1.2   20    1-20      7-26  (189)
 98 1fzq_A ADP-ribosylation factor  22.7      22 0.00093   16.9   0.9   15    1-15     22-36  (181)
 99 2eyu_A Twitching motility prot  22.4      36  0.0015   15.8   1.9   17    2-18     32-48  (261)
100 2h17_A ADP-ribosylation factor  22.1      22 0.00091   17.0   0.8   15    1-15     27-41  (181)
101 1zcb_A G alpha I/13; GTP-bindi  21.9      26  0.0011   16.5   1.2   13    2-14     40-52  (362)
102 2dyk_A GTP-binding protein; GT  21.5      29  0.0012   16.3   1.4   19    1-21      7-25  (161)
103 2h57_A ADP-ribosylation factor  21.5      19  0.0008   17.3   0.4   15    1-15     27-41  (190)
104 2vli_A Antibiotic resistance p  21.4      27  0.0011   16.4   1.2   16    1-16     11-26  (183)
105 3llu_A RAS-related GTP-binding  21.2      26  0.0011   16.5   1.1   16    1-16     26-41  (196)
106 1upt_A ARL1, ADP-ribosylation   21.2      33  0.0014   16.0   1.6   16    1-16     13-28  (171)
107 2pez_A Bifunctional 3'-phospho  20.9      34  0.0014   16.0   1.6   15    1-15     11-25  (179)
108 1g16_A RAS-related protein SEC  20.9      25  0.0011   16.6   0.9   16    1-16      9-24  (170)
109 1azs_C GS-alpha; complex (lyas  20.6      26  0.0011   16.6   0.9   13    2-14     47-59  (402)
110 1zuh_A Shikimate kinase; alpha  20.5      30  0.0013   16.2   1.2   15    1-15     13-27  (168)
111 2p67_A LAO/AO transport system  20.4      43  0.0018   15.4   2.0   34    2-35     63-99  (341)
112 1kag_A SKI, shikimate kinase I  20.4      30  0.0013   16.2   1.2   15    1-15     10-24  (173)
113 2gj8_A MNME, tRNA modification  20.2      29  0.0012   16.3   1.1   19    1-21     10-28  (172)
114 3a1s_A Iron(II) transport prot  20.1      39  0.0016   15.7   1.7   16    1-16     11-26  (258)
115 2pbr_A DTMP kinase, thymidylat  20.1      36  0.0015   15.8   1.6   15    2-16      7-21  (195)

No 1  
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10
Probab=81.04  E-value=0.43  Score=26.06  Aligned_cols=16  Identities=50%  Similarity=0.708  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.||||||++.+-
T Consensus        10 ~G~~gSGKTTLi~~Li   25 (169)
T 1xjc_A           10 VGYKHSGKTTLMEKWV   25 (169)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHH
T ss_conf             8199998999999999


No 2  
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A
Probab=76.43  E-value=0.85  Score=24.49  Aligned_cols=16  Identities=44%  Similarity=0.580  Sum_probs=13.8

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |.|.||||||+|.+.-
T Consensus        13 G~~~SGKTTLi~~li~   28 (174)
T 1np6_A           13 AWSGTGKTTLLKKLIP   28 (174)
T ss_dssp             CCTTSCHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             0699989999999999


No 3  
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12
Probab=69.56  E-value=1.4  Score=23.38  Aligned_cols=20  Identities=45%  Similarity=0.924  Sum_probs=15.9

Q ss_pred             CCCCCCHHHHHHHH-HHHHHH
Q ss_conf             74544502689999-874343
Q gi|254781089|r    2 GLSESGKTTLLEAI-FLFGEA   21 (80)
Q Consensus         2 glsesgkttlleai-flfgea   21 (80)
                      |-..||||++|+|| |++|+.
T Consensus        31 G~NgsGKS~iL~Ai~~~lg~~   51 (322)
T 1e69_A           31 GPNGSGKSNIIDAIKWVFGEQ   51 (322)
T ss_dssp             CCTTTCSTHHHHHHHHTSCC-
T ss_pred             CCCCCCHHHHHHHHHHHHCCC
T ss_conf             889985999999999996677


No 4  
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, ABC ATPase, dimer, kleisin, mitosis, cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12
Probab=68.89  E-value=1.8  Score=22.73  Aligned_cols=19  Identities=37%  Similarity=0.681  Sum_probs=14.8

Q ss_pred             CCCCCCHHHHHHHHH-HHHH
Q ss_conf             745445026899998-7434
Q gi|254781089|r    2 GLSESGKTTLLEAIF-LFGE   20 (80)
Q Consensus         2 glsesgkttlleaif-lfge   20 (80)
                      |-..||||++||||- ++|.
T Consensus        33 G~NGsGKS~ileAi~~~lg~   52 (430)
T 1w1w_A           33 GPNGSGKSNMMDAISFVLGV   52 (430)
T ss_dssp             CSTTSSHHHHHHHHHHHTTC
T ss_pred             CCCCCCHHHHHHHHHHHHCC
T ss_conf             99999889999999999677


No 5  
>1ii8_A RAD50 ABC-ATPase; MRE11, DNA double-strand break repair, replication; 3.02A {Pyrococcus furiosus} SCOP: c.37.1.12
Probab=66.79  E-value=2.3  Score=22.16  Aligned_cols=19  Identities=47%  Similarity=0.768  Sum_probs=15.6

Q ss_pred             CCCCCCHHHHHHHHH--HHHH
Q ss_conf             745445026899998--7434
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGE   20 (80)
Q Consensus         2 glsesgkttlleaif--lfge   20 (80)
                      |-..+||||+++||.  |||.
T Consensus        30 G~NGsGKStil~Ai~~~L~g~   50 (195)
T 1ii8_A           30 GQNGSGKSSLLDAILVGLYWP   50 (195)
T ss_dssp             CCTTSSHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCHHHHHHHHCCCC
T ss_conf             889998200877467760488


No 6  
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12
Probab=63.43  E-value=2.2  Score=22.25  Aligned_cols=16  Identities=31%  Similarity=0.437  Sum_probs=13.8

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-..|||||+|+||.+
T Consensus        34 G~NGsGKStil~Ai~~   49 (227)
T 1qhl_A           34 GGNGAGKSTTMAAFVT   49 (227)
T ss_dssp             SCCSHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             8999987999999999


No 7  
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}
Probab=63.40  E-value=3.8  Score=21.04  Aligned_cols=37  Identities=24%  Similarity=0.310  Sum_probs=20.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHEECCCCEEEEEEHHHHCCC
Q ss_conf             9745445026899998743432101238812467610220231
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGI   43 (80)
Q Consensus         1 mglsesgkttlleaiflfgealalalsndpvsvflksdvfdgi   43 (80)
                      +|||-|||||+-.++...-+      ....-.++|..|.+-.+
T Consensus       378 tGlsgsGKtTia~~l~~~l~------~~~~~~~~LDGD~lR~~  414 (546)
T 2gks_A          378 TGLPCAGKSTIAEILATMLQ------ARGRKVTLLDGDVVRTH  414 (546)
T ss_dssp             ECSTTSSHHHHHHHHHHHHH------HTTCCEEEECHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHH------HCCCEEEEEECHHHHHH
T ss_conf             46889807699999999986------25964999827899976


No 8  
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}
Probab=61.67  E-value=1.4  Score=23.37  Aligned_cols=16  Identities=50%  Similarity=0.812  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|-+-||||||+..|-
T Consensus         8 vG~nGsGKTTLl~~l~   23 (171)
T 2f1r_A            8 VGTSDSGKTTLITRMM   23 (171)
T ss_dssp             EESCHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8599988999999997


No 9  
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}
Probab=59.16  E-value=11  Score=18.56  Aligned_cols=17  Identities=53%  Similarity=0.741  Sum_probs=14.1

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |--.||||++||||.+.
T Consensus        33 G~NgsGKS~ILeAI~l~   49 (359)
T 2o5v_A           33 GENGAGKTNLLEAAYLA   49 (359)
T ss_dssp             CCTTSSHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHH
T ss_conf             99988399999999997


No 10 
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*
Probab=58.56  E-value=3.8  Score=21.01  Aligned_cols=19  Identities=47%  Similarity=0.768  Sum_probs=15.0

Q ss_pred             CCCCCCHHHHHHHHH--HHHH
Q ss_conf             745445026899998--7434
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGE   20 (80)
Q Consensus         2 glsesgkttlleaif--lfge   20 (80)
                      |-..+||||+++||.  |+|.
T Consensus        30 G~Ng~GKStil~Ai~~~l~~~   50 (149)
T 1f2t_A           30 GQNGSGKSSLLDAILVGLYWP   50 (149)
T ss_dssp             CCTTSSHHHHHHHHHHHHHCS
T ss_pred             CCCCCCCCHHHHHHHHHHHCC
T ss_conf             999997437999999986077


No 11 
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}
Probab=55.59  E-value=3.9  Score=20.99  Aligned_cols=16  Identities=50%  Similarity=0.675  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|||-|||||+-.++.
T Consensus       375 tGlsGsGKTTla~~l~  390 (552)
T 3cr8_A          375 TGLSGAGKSTLARALA  390 (552)
T ss_dssp             EESSCHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             5789998769999999


No 12 
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) class, TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima MSB8}
Probab=53.21  E-value=3.9  Score=20.95  Aligned_cols=18  Identities=39%  Similarity=0.366  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-||||||+..|.-+
T Consensus        35 lGpsGsGKsTll~~iaGl   52 (359)
T 2yyz_A           35 LGPSGCGKTTTLLMLAGI   52 (359)
T ss_dssp             ECSTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998699999999759


No 13 
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A
Probab=52.37  E-value=4.9  Score=20.45  Aligned_cols=18  Identities=44%  Similarity=0.466  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||||||..|.-+
T Consensus        35 ~GpsGsGKsTll~~i~Gl   52 (372)
T 1g29_1           35 LGPSGCGKTTTLRMIAGL   52 (372)
T ss_dssp             ECSTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999996499999999739


No 14 
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*
Probab=50.78  E-value=5.3  Score=20.24  Aligned_cols=16  Identities=50%  Similarity=0.584  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|||-|||||+-.++.
T Consensus        31 tGlsGSGKTTiA~~L~   46 (211)
T 1m7g_A           31 TGLSASGKSTLAVELE   46 (211)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999998899999999


No 15 
>1l2t_A Hypothetical ABC transporter ATP-binding protein MJ0796; ABC transporters, ATPase, walker-A, NBD, transport protein; HET: ATP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1f3o_A*
Probab=50.45  E-value=4.6  Score=20.57  Aligned_cols=16  Identities=56%  Similarity=0.661  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-|-||||||+..|-
T Consensus        37 vG~SGsGKSTLl~~i~   52 (235)
T 1l2t_A           37 MGPSGSGKSTMLNIIG   52 (235)
T ss_dssp             ECSTTSSHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8899998999999998


No 16 
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}
Probab=50.06  E-value=4.7  Score=20.52  Aligned_cols=17  Identities=53%  Similarity=0.544  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|-|-|||||||..|--
T Consensus        35 lGpsGsGKsTll~~iaG   51 (362)
T 2it1_A           35 LGPSGSGKSTLLYTIAG   51 (362)
T ss_dssp             ECCTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99998549999999974


No 17 
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*
Probab=49.89  E-value=4.8  Score=20.49  Aligned_cols=18  Identities=44%  Similarity=0.466  Sum_probs=13.8

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-|||||||..|--+
T Consensus        43 lGpsGsGKSTll~~iaGl   60 (372)
T 1v43_A           43 LGPSGCGKTTTLRMIAGL   60 (372)
T ss_dssp             ECCTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998599999999749


No 18 
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*
Probab=49.62  E-value=4.9  Score=20.46  Aligned_cols=18  Identities=44%  Similarity=0.682  Sum_probs=14.6

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-||||||+..|.-+
T Consensus        56 iG~sGsGKSTLl~~i~Gl   73 (263)
T 2olj_A           56 IGPSGSGKSTFLRCLNLL   73 (263)
T ss_dssp             ECCTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             889999899997787189


No 19 
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*
Probab=47.18  E-value=6.6  Score=19.75  Aligned_cols=21  Identities=38%  Similarity=0.501  Sum_probs=15.6

Q ss_pred             CCCCCCHHHHHHHHH--HHHHHH
Q ss_conf             745445026899998--743432
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGEAL   22 (80)
Q Consensus         2 glsesgkttlleaif--lfgeal   22 (80)
                      |-..||||++++||.  |||.+.
T Consensus        33 G~NGsGKSsildAi~~~l~g~~~   55 (182)
T 3kta_A           33 GANGSGKSNIGDAILFVLGGLSA   55 (182)
T ss_dssp             ECTTSSHHHHHHHHHHHTTCCCT
T ss_pred             CCCCCCCHHHHHHHHHHCCCCCH
T ss_conf             99999721476777864164201


No 20 
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, hydrolase; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*
Probab=46.79  E-value=6.7  Score=19.70  Aligned_cols=17  Identities=41%  Similarity=0.456  Sum_probs=13.9

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |-.-||||||++++.-.
T Consensus        21 G~~GaGKTTLl~~Ll~~   37 (262)
T 1yrb_A           21 GTAGSGKTTLTGEFGRY   37 (262)
T ss_dssp             CSTTSSHHHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHHHH
T ss_conf             18998099999999998


No 21 
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12
Probab=45.40  E-value=6.2  Score=19.90  Aligned_cols=17  Identities=47%  Similarity=0.671  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|.|-||||||+.+|.-
T Consensus        38 vG~sGsGKSTLl~~i~G   54 (262)
T 1b0u_A           38 IGSSGSGKSTFLRCINF   54 (262)
T ss_dssp             ECCTTSSHHHHHHHHTT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             97999759999999974


No 22 
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein LOLD; structural genomics, NPPSFA; 1.70A {Aquifex aeolicus VF5} PDB: 2pcl_A
Probab=45.26  E-value=6.4  Score=19.80  Aligned_cols=18  Identities=50%  Similarity=0.619  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-||||||+..|--.
T Consensus        36 iGpsGsGKSTLl~~i~gl   53 (224)
T 2pcj_A           36 IGASGSGKSTLLYILGLL   53 (224)
T ss_dssp             EECTTSCHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHHC
T ss_conf             999998499999999717


No 23 
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}
Probab=45.07  E-value=5.5  Score=20.16  Aligned_cols=17  Identities=47%  Similarity=0.573  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-|||||||..|--
T Consensus        36 lGpsGsGKSTllr~i~G   52 (359)
T 3fvq_A           36 IGASGCGKTTLLRCLAG   52 (359)
T ss_dssp             EESTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99998649999999974


No 24 
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}
Probab=44.56  E-value=6.5  Score=19.79  Aligned_cols=17  Identities=53%  Similarity=0.565  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-|||||||..|--
T Consensus        47 lGpsGsGKSTllr~iaG   63 (355)
T 1z47_A           47 LGPSGSGKTTILRLIAG   63 (355)
T ss_dssp             ECSTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99998459999999975


No 25 
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12
Probab=43.58  E-value=5.2  Score=20.28  Aligned_cols=18  Identities=44%  Similarity=0.604  Sum_probs=12.6

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-|||||||..|--+
T Consensus        32 ~GpsGsGKSTll~~iaGl   49 (348)
T 3d31_A           32 LGPTGAGKTLFLELIAGF   49 (348)
T ss_dssp             ECCCTHHHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999997499999999759


No 26 
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*
Probab=43.41  E-value=8.7  Score=19.09  Aligned_cols=16  Identities=31%  Similarity=0.474  Sum_probs=12.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|||-|||||+-.++.
T Consensus       402 tGLsGsGKTTia~~l~  417 (573)
T 1m8p_A          402 TGYMNSGKDAIARALQ  417 (573)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             5789987759999999


No 27 
>2awn_A Maltose/maltodextrin import ATP-binding protein MALK; ATP-binding cassette, transport protein; HET: ADP; 2.30A {Escherichia coli K12} SCOP: b.40.6.3 c.37.1.12 PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 2r6g_A* 1q1b_A
Probab=43.06  E-value=7.1  Score=19.59  Aligned_cols=18  Identities=44%  Similarity=0.523  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-+||||||..|--+
T Consensus        35 lGpsG~GKSTllr~iaGl   52 (381)
T 2awn_A           35 VGPSGCGKSTLLRMIAGL   52 (381)
T ss_dssp             ECCTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998299999999759


No 28 
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A*
Probab=42.58  E-value=7.2  Score=19.53  Aligned_cols=17  Identities=47%  Similarity=0.591  Sum_probs=12.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      ||-..+|||||++++..
T Consensus        11 ~GHVD~GKTTLld~l~~   27 (594)
T 1g7s_A           11 LGHVDHGKTTLLDHIRG   27 (594)
T ss_dssp             ECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHH
T ss_conf             97899879999999970


No 29 
>3dhw_C Methionine import ATP-binding protein METN; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: c.37.1.12 d.58.18.13
Probab=42.23  E-value=6.5  Score=19.78  Aligned_cols=17  Identities=41%  Similarity=0.704  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-||||||+..|-.
T Consensus        37 vG~SGsGKSTLlr~i~g   53 (343)
T 3dhw_C           37 IGASGAGKSTLIRCVNL   53 (343)
T ss_dssp             EESTTSSHHHHHHHHTT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99998349999999975


No 30 
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, non-SMC subunit, ABC-type ATPase, WHD, ATP; HET: ATG; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*
Probab=41.34  E-value=10  Score=18.67  Aligned_cols=20  Identities=25%  Similarity=0.421  Sum_probs=15.2

Q ss_pred             CCCCCCHHHHHHHHH--HHHHH
Q ss_conf             745445026899998--74343
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGEA   21 (80)
Q Consensus         2 glsesgkttlleaif--lfgea   21 (80)
                      |-..|||||+++||-  |+|.+
T Consensus        36 G~NGsGKStildAI~~~L~g~~   57 (483)
T 3euj_A           36 GGNGAGKSTTMAGFVTALIPDL   57 (483)
T ss_dssp             CCTTSSHHHHHHHHHHHHCCCT
T ss_pred             ECCCCHHHHHHHHHHHHHCCCC
T ss_conf             4887229999999999976698


No 31 
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.70A {Thermus thermophilus HB8} PDB: 2d2f_A*
Probab=41.05  E-value=8.5  Score=19.16  Aligned_cols=17  Identities=35%  Similarity=0.387  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|.+-||||||+..|.-
T Consensus        35 iG~nGaGKSTL~~~i~G   51 (250)
T 2d2e_A           35 MGPNGAGKSTLGKILAG   51 (250)
T ss_dssp             ECSTTSSHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             88899899999999856


No 32 
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}
Probab=40.01  E-value=8.4  Score=19.19  Aligned_cols=16  Identities=38%  Similarity=0.690  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-|-||||||+..+.
T Consensus        37 vG~sGsGKSTLl~ll~   52 (237)
T 2cbz_A           37 VGQVGCGKSSLLSALL   52 (237)
T ss_dssp             ECSTTSSHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999998999999996


No 33 
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A
Probab=39.44  E-value=9.3  Score=18.94  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|++-|||||+...+.
T Consensus         8 ~G~pGSGKST~a~~L~   23 (301)
T 1ltq_A            8 IGCPGSGKSTWAREFI   23 (301)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9989997999999999


No 34 
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12
Probab=39.40  E-value=8.7  Score=19.10  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-|||||++.+|--+
T Consensus        30 iGpsGsGKSTllr~i~Gl   47 (240)
T 2onk_A           30 LGPTGAGKSVFLELIAGI   47 (240)
T ss_dssp             ECCTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             979998199999999729


No 35 
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*
Probab=39.13  E-value=8.3  Score=19.20  Aligned_cols=16  Identities=50%  Similarity=0.711  Sum_probs=13.8

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|...+|||||+.++.
T Consensus        44 vG~pnaGKSTLln~L~   59 (226)
T 2hf9_A           44 MGAIGSGKTLLIEKLI   59 (226)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8899998999999999


No 36 
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Bacillus halodurans c-125} SCOP: c.37.1.25
Probab=38.92  E-value=8.9  Score=19.04  Aligned_cols=32  Identities=22%  Similarity=0.391  Sum_probs=19.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHEECCCCEEEEEEHHHHCC
Q ss_conf             974544502689999874343210123881246761022023
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDG   42 (80)
Q Consensus         1 mglsesgkttlleaiflfgealalalsndpvsvflksdvfdg   42 (80)
                      +|.+-|||||+...+-   +    .+   +..+|+..|.+--
T Consensus         8 ~G~~GsGKTTla~~La---~----~l---~~~~~~~~d~~r~   39 (189)
T 2bdt_A            8 TGPAGVGKSTTCKRLA---A----QL---DNSAYIEGDIINH   39 (189)
T ss_dssp             ECSTTSSHHHHHHHHH---H----HS---SSEEEEEHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH---H----HC---CCCEEEECHHHHH
T ss_conf             8999989899999999---9----80---9989986447788


No 37 
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*
Probab=38.91  E-value=6  Score=19.95  Aligned_cols=16  Identities=44%  Similarity=0.636  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-|-|||||||..|-
T Consensus        37 ~GpsGsGKSTllr~ia   52 (353)
T 1oxx_K           37 LGPSGAGKTTFMRIIA   52 (353)
T ss_dssp             ECSCHHHHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             9999975999999997


No 38 
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*
Probab=37.86  E-value=7.9  Score=19.33  Aligned_cols=19  Identities=42%  Similarity=0.616  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|+..+||||++..+ ..++
T Consensus        31 lG~~~sGKTSll~~l-~~~~   49 (198)
T 1f6b_A           31 LGLDNAGKTTLLHML-KDDR   49 (198)
T ss_dssp             EEETTSSHHHHHHHH-SCC-
T ss_pred             ECCCCCCHHHHHHHH-HCCC
T ss_conf             999999889999999-5788


No 39 
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12
Probab=37.77  E-value=9.6  Score=18.88  Aligned_cols=20  Identities=30%  Similarity=0.408  Sum_probs=15.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|-|-|||+||+..|.-+-+
T Consensus        34 vG~sGsGKSTLl~ll~gl~~   53 (243)
T 1mv5_A           34 AGPSGGGKSTIFSLLERFYQ   53 (243)
T ss_dssp             ECCTTSSHHHHHHHHTTSSC
T ss_pred             ECCCCCHHHHHHHHHHCCCC
T ss_conf             99998739999999967876


No 40 
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*
Probab=37.58  E-value=9.6  Score=18.86  Aligned_cols=15  Identities=40%  Similarity=0.714  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.|-|||||+..++
T Consensus        14 ~G~~GsGKST~a~~L   28 (175)
T 1knq_A           14 MGVSGSGKSAVASEV   28 (175)
T ss_dssp             ECSTTSCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             879999989999999


No 41 
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1
Probab=37.31  E-value=12  Score=18.44  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+-|||||+.+++.
T Consensus         8 ~G~pGsGKSTla~~L~   23 (181)
T 1ly1_A            8 IGCPGSGKSTWAREFI   23 (181)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999899999999


No 42 
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*
Probab=36.89  E-value=10  Score=18.76  Aligned_cols=18  Identities=50%  Similarity=0.599  Sum_probs=14.1

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-||||||+..+.-+
T Consensus        41 vG~sGsGKSTLl~ll~gl   58 (247)
T 2ff7_A           41 VGRSGSGKSTLTKLIQRF   58 (247)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998299999999777


No 43 
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}
Probab=36.71  E-value=10  Score=18.72  Aligned_cols=17  Identities=35%  Similarity=0.622  Sum_probs=13.9

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-+-||||||+..|.-
T Consensus        37 ~G~nGsGKSTLlk~i~G   53 (253)
T 2nq2_C           37 LGQNGCGKSTLLDLLLG   53 (253)
T ss_dssp             ECCSSSSHHHHHHHHTT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             88999969999999956


No 44 
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}
Probab=36.19  E-value=11  Score=18.50  Aligned_cols=16  Identities=44%  Similarity=0.584  Sum_probs=13.8

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+.++.
T Consensus        54 vG~~n~GKTSLl~~l~   69 (193)
T 2ged_A           54 AGPQNSGKTSLLTLLT   69 (193)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999899999995


No 45 
>2yz2_A Putative ABC transporter ATP-binding protein TM_0222; cobalt transport, hydrolase, inner membrane, membrane, nucleotide- binding; 2.30A {Thermotoga maritima MSB8}
Probab=35.94  E-value=11  Score=18.64  Aligned_cols=16  Identities=44%  Similarity=0.611  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-|-||||||+..|-
T Consensus        39 iG~nGaGKSTLlk~i~   54 (266)
T 2yz2_A           39 AGNTGSGKSTLLQIVA   54 (266)
T ss_dssp             ECSTTSSHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999999999996


No 46 
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}
Probab=35.71  E-value=11  Score=18.60  Aligned_cols=16  Identities=31%  Similarity=0.484  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-+-||||||+..|.
T Consensus        40 iG~nGaGKSTLl~~i~   55 (275)
T 3gfo_A           40 LGGNGVGKSTLFQNFN   55 (275)
T ss_dssp             ECCTTSSHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             9999983999999997


No 47 
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}
Probab=35.54  E-value=11  Score=18.58  Aligned_cols=17  Identities=47%  Similarity=0.647  Sum_probs=13.8

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-+-+|||||+..|.-
T Consensus        53 iGpNGaGKSTLl~~i~G   69 (279)
T 2ihy_A           53 YGLNGAGKTTLLNILNA   69 (279)
T ss_dssp             ECCTTSSHHHHHHHHTT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99999649999999965


No 48 
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}
Probab=34.64  E-value=12  Score=18.45  Aligned_cols=16  Identities=63%  Similarity=0.754  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-+-||||||+..|.
T Consensus        36 iGpNGaGKSTLlk~i~   51 (263)
T 2pjz_A           36 LGPNGSGKTTLLRAIS   51 (263)
T ss_dssp             ECCTTSSHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             9899984999999996


No 49 
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Aeropyrum pernix K1}
Probab=34.49  E-value=12  Score=18.43  Aligned_cols=16  Identities=44%  Similarity=0.584  Sum_probs=12.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|++-|||||+-.++.
T Consensus        19 tG~~GSGKSTlAk~La   34 (186)
T 2yvu_A           19 TGLPGSGKTTIATRLA   34 (186)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999999999999


No 50 
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11
Probab=34.39  E-value=14  Score=18.04  Aligned_cols=15  Identities=47%  Similarity=0.621  Sum_probs=12.8

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-+-||||||+.++-
T Consensus         7 G~~GsGKTTLlk~ia   21 (178)
T 1ye8_A            7 GEPGVGKTTLVKKIV   21 (178)
T ss_dssp             CCTTSSHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             999970999999999


No 51 
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A
Probab=34.32  E-value=12  Score=18.41  Aligned_cols=16  Identities=44%  Similarity=0.632  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-|-||||||+..|.
T Consensus        40 vG~sGsGKSTLl~ll~   55 (229)
T 2pze_A           40 AGSTGAGKTSLLMMIM   55 (229)
T ss_dssp             ECCTTSSHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             9999883999999995


No 52 
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*
Probab=34.25  E-value=10  Score=18.70  Aligned_cols=18  Identities=39%  Similarity=0.409  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-||||||+..|.-+
T Consensus        70 vG~sGsGKSTLl~li~Gl   87 (290)
T 2bbs_A           70 AGSTGAGKTSLLMMIMGE   87 (290)
T ss_dssp             EESTTSSHHHHHHHHTTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999997599999999678


No 53 
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A
Probab=34.20  E-value=12  Score=18.34  Aligned_cols=22  Identities=41%  Similarity=0.782  Sum_probs=13.4

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             7454450268999987434321
Q gi|254781089|r    2 GLSESGKTTLLEAIFLFGEALA   23 (80)
Q Consensus         2 glsesgkttlleaiflfgeala   23 (80)
                      |-..+|||||.|++.....+..
T Consensus        20 gHvd~GKTTL~e~lL~~~g~i~   41 (529)
T 2h5e_A           20 SHPDAGKTTITEKVLLFGQAIQ   41 (529)
T ss_dssp             ECTTSSHHHHHHHHHHSCC---
T ss_pred             CCCCCCHHHHHHHHHHHCCCCC
T ss_conf             6899899999999997577100


No 54 
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*
Probab=33.98  E-value=11  Score=18.54  Aligned_cols=18  Identities=44%  Similarity=0.650  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|.+-+|||||+.+|.-+
T Consensus        39 iGpnGaGKSTL~~~i~G~   56 (257)
T 1g6h_A           39 IGPNGSGKSTLINVITGF   56 (257)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999998699999999789


No 55 
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*
Probab=33.59  E-value=13  Score=18.23  Aligned_cols=15  Identities=47%  Similarity=0.705  Sum_probs=12.6

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |.+-|||||+...+-
T Consensus        28 G~~GSGKTTla~~L~   42 (207)
T 2qt1_A           28 GVTNSGKTTLAKNLQ   42 (207)
T ss_dssp             ESTTSSHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             989885999999999


No 56 
>1sgw_A Putative ABC transporter; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Pyrococcus furiosus dsm 3638} SCOP: c.37.1.12
Probab=33.54  E-value=12  Score=18.30  Aligned_cols=17  Identities=47%  Similarity=0.507  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|-+-+|||||+..|.-
T Consensus        41 iG~NGsGKSTLl~~l~g   57 (214)
T 1sgw_A           41 HGPNGIGKTTLLKTIST   57 (214)
T ss_dssp             ECCTTSSHHHHHHHHTT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             99999839999999966


No 57 
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1
Probab=33.08  E-value=11  Score=18.58  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=10.0

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus       219 FGLSGTGKTTLS  230 (524)
T 1ii2_A          219 FGLSGTGKTTLS  230 (524)
T ss_dssp             ECCTTSSHHHHH
T ss_pred             EECCCCCCEEEE
T ss_conf             951688615776


No 58 
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus dsm 4304} PDB: 2oaq_1
Probab=32.53  E-value=15  Score=17.86  Aligned_cols=17  Identities=59%  Similarity=0.857  Sum_probs=13.6

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |-..|||||+|.|+..+
T Consensus       267 G~tgSGKTT~L~all~~  283 (511)
T 2oap_1          267 GETASGKTTTLNAIMMF  283 (511)
T ss_dssp             ESTTSSHHHHHHHHGGG
T ss_pred             CCCCCCHHHHHHHHHHH
T ss_conf             99989889999999996


No 59 
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*
Probab=32.27  E-value=16  Score=17.75  Aligned_cols=15  Identities=33%  Similarity=0.452  Sum_probs=12.7

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |.+-|||||+...+-
T Consensus         7 G~~GsGKST~~k~L~   21 (205)
T 2jaq_A            7 GTVGAGKSTISAEIS   21 (205)
T ss_dssp             CCTTSCHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             889878999999999


No 60 
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A
Probab=32.26  E-value=11  Score=18.46  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=10.3

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus       241 FGLSGTGKTTLs  252 (532)
T 1ytm_A          241 FGLSGTGKTTLS  252 (532)
T ss_dssp             ECCTTSSHHHHH
T ss_pred             ECCCCCCCCEEE
T ss_conf             614677775352


No 61 
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}
Probab=32.26  E-value=14  Score=18.04  Aligned_cols=17  Identities=47%  Similarity=0.692  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|-|-||||||+..|.-
T Consensus        53 vG~sGsGKSTLl~li~G   69 (390)
T 3gd7_A           53 LGRTGSGKSTLLSAFLR   69 (390)
T ss_dssp             EESTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99999829999999857


No 62 
>2rhm_A Putative kinase; ZP_00765535.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Chloroflexus aurantiacus j-10-fl}
Probab=31.96  E-value=14  Score=18.00  Aligned_cols=14  Identities=50%  Similarity=0.719  Sum_probs=12.1

Q ss_pred             CCCCCCHHHHHHHH
Q ss_conf             74544502689999
Q gi|254781089|r    2 GLSESGKTTLLEAI   15 (80)
Q Consensus         2 glsesgkttlleai   15 (80)
                      |.+-|||||+..++
T Consensus        12 G~~GsGKTTla~~L   25 (193)
T 2rhm_A           12 GHPATGKTTLSQAL   25 (193)
T ss_dssp             ESTTSSHHHHHHHH
T ss_pred             CCCCCCHHHHHHHH
T ss_conf             68999979999999


No 63 
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8
Probab=31.76  E-value=12  Score=18.35  Aligned_cols=16  Identities=44%  Similarity=0.659  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..+.
T Consensus        22 iG~~~~GKTsli~~l~   37 (187)
T 1zj6_A           22 VGLDNAGKTTILYQFS   37 (187)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999988799999997


No 64 
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C*
Probab=31.72  E-value=14  Score=18.04  Aligned_cols=38  Identities=24%  Similarity=0.405  Sum_probs=21.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHEECCCCEEEEEEHHHHCCCCCC
Q ss_conf             9745445026899998743432101238812467610220231134
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKN   46 (80)
Q Consensus         1 mglsesgkttlleaiflfgealalalsndpvsvflksdvfdgiskn   46 (80)
                      +|-+-+|||||+..|.  |  +    ..+--++.+...-...-+.+
T Consensus        32 iGpNGaGKSTLl~~l~--G--l----~~~~G~I~~~G~~i~~~~~~   69 (249)
T 2qi9_C           32 VGPNGAGKSTLLARMA--G--M----TSGKGSIQFAGQPLEAWSAT   69 (249)
T ss_dssp             ECCTTSSHHHHHHHHT--T--S----SCCEEEEEETTEEGGGSCHH
T ss_pred             ECCCCCCHHHHHHHHH--C--C----CCCCEEEEECCEECCCCCHH
T ss_conf             9899981999999994--7--8----78966999999999859989


No 65 
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}
Probab=31.69  E-value=14  Score=18.04  Aligned_cols=17  Identities=29%  Similarity=0.595  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-|||+||+..+.-
T Consensus        52 vG~sGsGKSTLl~ll~g   68 (260)
T 2ghi_A           52 VGHTGSGKSTIAKLLYR   68 (260)
T ss_dssp             ECSTTSSHHHHHHHHTT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99999879999999947


No 66 
>2wsm_A Hydrogenase expression/formation protein (HYPB); hydrogenase maturation factor, metal binding protein; 2.30A {Archaeoglobus fulgidus}
Probab=31.63  E-value=12  Score=18.34  Aligned_cols=16  Identities=50%  Similarity=0.636  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|...+|||||+.++.
T Consensus        36 vG~pnaGKSTLln~L~   51 (221)
T 2wsm_A           36 MGAIGSGKTLLIERTI   51 (221)
T ss_dssp             EECTTSCHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8899998999999999


No 67 
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*
Probab=31.60  E-value=16  Score=17.65  Aligned_cols=15  Identities=27%  Similarity=0.490  Sum_probs=12.0

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|++-|||||+-.++
T Consensus         9 ~G~~GsGKsTvA~~L   23 (178)
T 1qhx_A            9 NGGSSAGKSGIVRCL   23 (178)
T ss_dssp             ECCTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999989999999


No 68 
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, disease mutation, mitochondrion, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}
Probab=31.45  E-value=29  Score=16.34  Aligned_cols=33  Identities=30%  Similarity=0.373  Sum_probs=21.2

Q ss_pred             CCCCCCHHHHHHHHHH-H-HHHHHH-EECCCCEEEE
Q ss_conf             7454450268999987-4-343210-1238812467
Q gi|254781089|r    2 GLSESGKTTLLEAIFL-F-GEALAL-ALSNDPVSVF   34 (80)
Q Consensus         2 glsesgkttlleaifl-f-gealal-alsndpvsvf   34 (80)
                      |-.-+|||||+++.-. + ...+.+ .+.+||.|-+
T Consensus        81 G~PGaGKStli~~l~~~~~~~g~~vaVla~Dpss~~  116 (349)
T 2www_A           81 GPPGAGKSTFIEYFGKMLTERGHKLSVLAVDPSSCT  116 (349)
T ss_dssp             CCTTSSHHHHHHHHHHHHHHTTCCEEEEECCC----
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHH
T ss_conf             799988999999999999847971789957878662


No 69 
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3add_A* 3adc_A* 3adb_A*
Probab=30.98  E-value=14  Score=17.94  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|++-|||||+-.++-
T Consensus        10 ~G~PGSGKST~A~~L~   25 (260)
T 3a4m_A           10 TGLPGVGKSTFSKNLA   25 (260)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999998899999999


No 70 
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A*
Probab=30.75  E-value=9.4  Score=18.93  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=10.0

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus       231 FGLSGTGKTTLS  242 (529)
T 1j3b_A          231 FGLSGTGKTTLS  242 (529)
T ss_dssp             EECTTSCHHHHT
T ss_pred             EECCCCCCCEEC
T ss_conf             722788761523


No 71 
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2
Probab=30.45  E-value=15  Score=17.86  Aligned_cols=16  Identities=44%  Similarity=0.760  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus        13 vG~~~~GKTsLl~~l~   28 (214)
T 2fh5_B           13 VGLCDSGKTLLFVRLL   28 (214)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9899988899999997


No 72 
>1m2o_B GTP binding, GTP-binding protein SAR1; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*
Probab=29.98  E-value=13  Score=18.10  Aligned_cols=15  Identities=53%  Similarity=0.915  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|...+|||||+..+
T Consensus        29 vG~~~~GKTsLl~~l   43 (190)
T 1m2o_B           29 LGLDNAGKTTLLHML   43 (190)
T ss_dssp             EESTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999999989999999


No 73 
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A*
Probab=29.97  E-value=13  Score=18.13  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=9.9

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus       247 FGLSGTGKTTLS  258 (540)
T 2olr_A          247 FGLSGTGKTTLS  258 (540)
T ss_dssp             ECSTTSSHHHHH
T ss_pred             EECCCCCCEEEC
T ss_conf             730666652551


No 74 
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis 1330}
Probab=29.96  E-value=17  Score=17.54  Aligned_cols=17  Identities=47%  Similarity=0.604  Sum_probs=13.4

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |-..|||||++.|+.-+
T Consensus       182 G~tgSGKTTll~al~~~  198 (361)
T 2gza_A          182 GETGSGKTTLMKALMQE  198 (361)
T ss_dssp             ESSSSCHHHHHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHH
T ss_conf             99999789999999862


No 75 
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8
Probab=29.84  E-value=15  Score=17.77  Aligned_cols=16  Identities=44%  Similarity=0.584  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus        18 vG~~n~GKSsLin~l~   33 (218)
T 1nrj_B           18 AGPQNSGKTSLLTLLT   33 (218)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999999999996


No 76 
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A
Probab=29.83  E-value=17  Score=17.61  Aligned_cols=16  Identities=44%  Similarity=0.578  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|-+-||||||+.+|.
T Consensus        52 iG~nGaGKSTL~~~i~   67 (267)
T 2zu0_C           52 MGPNGSGKSTLSATLA   67 (267)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999999999985


No 77 
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12
Probab=29.71  E-value=14  Score=17.93  Aligned_cols=18  Identities=44%  Similarity=0.528  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-+-+|||||+..|.=+
T Consensus        38 iGpNGaGKSTll~~i~Gl   55 (240)
T 1ji0_A           38 IGANGAGKTTTLSAIAGL   55 (240)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999998499999999779


No 78 
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*
Probab=29.56  E-value=17  Score=17.57  Aligned_cols=16  Identities=31%  Similarity=0.603  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus         9 vG~~~~GKSsLi~~L~   24 (165)
T 2wji_A            9 IGNPNVGKSTIFNALT   24 (165)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9899998999999997


No 79 
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*
Probab=28.76  E-value=17  Score=17.62  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||+||+..|.-+
T Consensus        51 vG~sGsGKSTLl~ll~gl   68 (271)
T 2ixe_A           51 VGPNGSGKSTVAALLQNL   68 (271)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998699999999767


No 80 
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A
Probab=27.82  E-value=21  Score=17.10  Aligned_cols=15  Identities=27%  Similarity=0.353  Sum_probs=12.9

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |.+-|||||+..++.
T Consensus        10 G~~GsGKTT~~~~L~   24 (192)
T 1kht_A           10 GVPGVGSTTSSQLAM   24 (192)
T ss_dssp             CCTTSCHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             999959899999999


No 81 
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*
Probab=27.75  E-value=17  Score=17.58  Aligned_cols=16  Identities=25%  Similarity=0.609  Sum_probs=13.9

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+||+||+.+++
T Consensus        29 vG~~nvGKSSLiN~L~   44 (195)
T 1svi_A           29 AGRSNVGKSSFINSLI   44 (195)
T ss_dssp             EEBTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999984999999996


No 82 
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural genomics, joint center for structural genomics, JCSG; 2.10A {Thermotoga maritima MSB8} SCOP: c.37.1.12
Probab=27.73  E-value=18  Score=17.46  Aligned_cols=17  Identities=41%  Similarity=0.491  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-+-+|||||+..|.-
T Consensus        47 lGpNGaGKSTLlk~i~G   63 (256)
T 1vpl_A           47 IGPNGAGKTTTLRIIST   63 (256)
T ss_dssp             ECCTTSSHHHHHHHHTT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             89999889999999966


No 83 
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6
Probab=27.47  E-value=19  Score=17.34  Aligned_cols=16  Identities=56%  Similarity=0.669  Sum_probs=13.1

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |.+-|||||+.+.+--
T Consensus        29 G~~GSGKSTla~~L~~   44 (201)
T 1rz3_A           29 GLSRSGKTTLANQLSQ   44 (201)
T ss_dssp             ECTTSSHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             9898899999999999


No 84 
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli}
Probab=26.70  E-value=16  Score=17.63  Aligned_cols=16  Identities=56%  Similarity=0.719  Sum_probs=11.0

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      ||-..+|||||++++-
T Consensus        10 ~Ghvd~GKTtL~d~l~   25 (501)
T 1zo1_I           10 MGHVDHGKTSLLEYIR   25 (501)
T ss_dssp             EESTTSSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9589999779999997


No 85 
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 2pz3_A* 2pz2_A* 1as0_A* 1as2_A* 1as3_A* 1gil_A* ...
Probab=26.31  E-value=19  Score=17.24  Aligned_cols=32  Identities=25%  Similarity=0.493  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHH-HEECCCCEEEEE-EHHHHC
Q ss_conf             68999987434321-012388124676-102202
Q gi|254781089|r   10 TLLEAIFLFGEALA-LALSNDPVSVFL-KSDVFD   41 (80)
Q Consensus        10 tlleaiflfgeala-lalsndpvsvfl-ksdvfd   41 (80)
                      .+.|++-||.+-.. -.+.+-|+-+|| |.|+|.
T Consensus       241 rl~esl~lF~~i~n~~~~~~~~iil~lnK~D~f~  274 (353)
T 1cip_A          241 RMHESMKLFDSICNNKWFTDTSIILFLNKKDLFE  274 (353)
T ss_dssp             HHHHHHHHHHHHHTCGGGTTSEEEEEEECHHHHH
T ss_pred             HHHHHHHHHHHHHCCHHHCCCCEEEEEECHHHHH
T ss_conf             8999999999996788558998799987878899


No 86 
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}
Probab=25.99  E-value=21  Score=17.03  Aligned_cols=16  Identities=31%  Similarity=0.603  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+-+|||||+.++.
T Consensus        13 vG~~~vGKSSLin~l~   28 (188)
T 2wjg_A           13 IGNPNVGKSTIFNALT   28 (188)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999987999999996


No 87 
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*
Probab=25.98  E-value=20  Score=17.19  Aligned_cols=16  Identities=50%  Similarity=0.692  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..+.
T Consensus        28 vG~~~~GKTsLi~~l~   43 (188)
T 1zd9_A           28 VGLQYSGKTTFVNVIA   43 (188)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999899999997


No 88 
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A*
Probab=25.65  E-value=20  Score=17.14  Aligned_cols=32  Identities=28%  Similarity=0.468  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHH-EECCCCEEEEE-EHHHHC
Q ss_conf             689999874343210-12388124676-102202
Q gi|254781089|r   10 TLLEAIFLFGEALAL-ALSNDPVSVFL-KSDVFD   41 (80)
Q Consensus        10 tlleaiflfgealal-alsndpvsvfl-ksdvfd   41 (80)
                      .+.|++-+|.+-..- .+++-|+-+|+ |.|+|.
T Consensus       215 r~~eSl~lf~~i~n~~~~~~~~iil~lNK~D~f~  248 (327)
T 3ohm_A          215 RMEESKALFRTIITYPWFQNSSVILFLNKKDLLE  248 (327)
T ss_dssp             HHHHHHHHHHHHHTSGGGTTCEEEEEEECHHHHH
T ss_pred             HHHHHHHHHHHHHCCHHHCCCCEEEEEECCHHHH
T ss_conf             3999999999996797557987899972708999


No 89 
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, structural genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}
Probab=25.34  E-value=25  Score=16.66  Aligned_cols=15  Identities=40%  Similarity=0.547  Sum_probs=12.7

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-+-|||||+..++-
T Consensus        29 G~~gSGKSTla~~L~   43 (208)
T 3c8u_A           29 GAPGSGKSTLSNPLA   43 (208)
T ss_dssp             CCTTSCTHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             989899999999999


No 90 
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}
Probab=25.07  E-value=15  Score=17.89  Aligned_cols=15  Identities=47%  Similarity=0.780  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||+|+..+
T Consensus       171 iG~~~vGKSSLl~rl  185 (329)
T 3o47_A          171 VGLDAAGKTTILYKL  185 (329)
T ss_dssp             EESTTSSHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999998599999999


No 91 
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolase/protein binding complex; 2.40A {Helicobacter pylori 26695} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A
Probab=24.67  E-value=20  Score=17.12  Aligned_cols=16  Identities=44%  Similarity=0.580  Sum_probs=11.3

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-..|||||++.|+.-
T Consensus       178 G~tgSGKTTll~al~~  193 (330)
T 2pt7_A          178 GGTGSGKTTYIKSIME  193 (330)
T ss_dssp             ESTTSCHHHHHHHGGG
T ss_pred             EECCCCHHHHHHHHHH
T ss_conf             6079998999999973


No 92 
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25
Probab=24.46  E-value=23  Score=16.87  Aligned_cols=15  Identities=47%  Similarity=0.652  Sum_probs=12.3

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|.+-|||||+..++
T Consensus        15 ~G~~GsGKTT~a~~L   29 (191)
T 1zp6_A           15 SGHPGSGKSTIAEAL   29 (191)
T ss_dssp             EECTTSCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999889999999


No 93 
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}
Probab=24.10  E-value=24  Score=16.70  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..+.
T Consensus        34 ~G~~~vGKTsLi~~~~   49 (199)
T 2p5s_A           34 AGDAAVGKSSFLMRLC   49 (199)
T ss_dssp             ESSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999979899999996


No 94 
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*
Probab=23.97  E-value=21  Score=17.08  Aligned_cols=18  Identities=44%  Similarity=0.792  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||+||+..|.-+
T Consensus        86 vG~sGsGKSTLl~ll~gl  103 (306)
T 3nh6_A           86 VGPSGAGKSTILRLLFRF  103 (306)
T ss_dssp             ESSSCHHHHHHHHHHTTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998699999999656


No 95 
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}
Probab=23.01  E-value=26  Score=16.54  Aligned_cols=15  Identities=27%  Similarity=0.472  Sum_probs=10.0

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-+-||||||+.+|-
T Consensus        54 G~NGaGKSTLlkiL~   68 (538)
T 1yqt_A           54 GPNGTGKSTAVKILA   68 (538)
T ss_dssp             CCTTSSHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHH
T ss_conf             999955999999996


No 96 
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum 3D7}
Probab=22.98  E-value=25  Score=16.70  Aligned_cols=16  Identities=19%  Similarity=0.466  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus        35 vG~~nvGKSSLln~L~   50 (228)
T 2qu8_A           35 SGAPNVGKSSFMNIVS   50 (228)
T ss_dssp             ECSTTSSHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999985999999984


No 97 
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11
Probab=22.92  E-value=25  Score=16.66  Aligned_cols=20  Identities=30%  Similarity=0.242  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      .|-+-+|||||+..+.-.-+
T Consensus         7 ~G~~GsGKTTL~~~l~~~l~   26 (189)
T 2i3b_A            7 TGPPGVGKTTLIHKASEVLK   26 (189)
T ss_dssp             ESCCSSCHHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHC
T ss_conf             89998229999999986616


No 98 
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*
Probab=22.67  E-value=22  Score=16.95  Aligned_cols=15  Identities=53%  Similarity=0.944  Sum_probs=12.5

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||||+..+
T Consensus        22 vG~~~~GKTsLi~~l   36 (181)
T 1fzq_A           22 LGLDNAGKTTLLKQL   36 (181)
T ss_dssp             EESTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999999899999999


No 99 
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}
Probab=22.39  E-value=36  Score=15.82  Aligned_cols=17  Identities=29%  Similarity=0.554  Sum_probs=13.4

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |-..|||||++.++.-+
T Consensus        32 G~tGSGKTT~l~all~~   48 (261)
T 2eyu_A           32 GPTGSGKSTTIASMIDY   48 (261)
T ss_dssp             CSTTCSHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHH
T ss_conf             99996399999999984


No 100
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*
Probab=22.15  E-value=22  Score=16.99  Aligned_cols=15  Identities=47%  Similarity=0.764  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||||+..+
T Consensus        27 vG~~~vGKTsLi~~l   41 (181)
T 2h17_A           27 VGLDNAGKTTILYQF   41 (181)
T ss_dssp             EEETTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999999989999999


No 101
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling protein; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A*
Probab=21.94  E-value=26  Score=16.52  Aligned_cols=13  Identities=54%  Similarity=0.831  Sum_probs=6.2

Q ss_pred             CCCCCCHHHHHHH
Q ss_conf             7454450268999
Q gi|254781089|r    2 GLSESGKTTLLEA   14 (80)
Q Consensus         2 glsesgkttllea   14 (80)
                      |-+||||+|++.-
T Consensus        40 G~geSGKST~~KQ   52 (362)
T 1zcb_A           40 GAGESGKSTFLKQ   52 (362)
T ss_dssp             CSTTSSHHHHHHH
T ss_pred             CCCCCCHHHHHHH
T ss_conf             8998748999999


No 102
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics, NPPSFA; HET: GDP; 1.96A {Thermus thermophilus HB8}
Probab=21.51  E-value=29  Score=16.28  Aligned_cols=19  Identities=21%  Similarity=0.522  Sum_probs=14.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             974544502689999874343
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEA   21 (80)
Q Consensus         1 mglsesgkttlleaiflfgea   21 (80)
                      +|.+.+|||||+.++.  |+.
T Consensus         7 vG~~nvGKSsLin~l~--~~~   25 (161)
T 2dyk_A            7 VGRPNVGKSSLFNRLL--KKR   25 (161)
T ss_dssp             ECCTTSSHHHHHHHHH--HCC
T ss_pred             ECCCCCHHHHHHHHHH--CCC
T ss_conf             8999971999999997--888


No 103
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}
Probab=21.51  E-value=19  Score=17.28  Aligned_cols=15  Identities=47%  Similarity=0.904  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||||+..+
T Consensus        27 vG~~nvGKSSLin~l   41 (190)
T 2h57_A           27 LGLDNSGKTTIINKL   41 (190)
T ss_dssp             EECTTSSHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999999899999999


No 104
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}
Probab=21.43  E-value=27  Score=16.45  Aligned_cols=16  Identities=25%  Similarity=0.225  Sum_probs=12.9

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.|-|||||+...+-
T Consensus        11 ~G~sGsGKSTva~~La   26 (183)
T 2vli_A           11 NGPFGVGKTHTAHTLH   26 (183)
T ss_dssp             ECCC----CHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9998834999999999


No 105
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*
Probab=21.22  E-value=26  Score=16.53  Aligned_cols=16  Identities=44%  Similarity=0.889  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..++
T Consensus        26 ~G~~~vGKSSLi~~l~   41 (196)
T 3llu_A           26 MGLRRSGKSSIQKVVF   41 (196)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9989989999999996


No 106
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*
Probab=21.16  E-value=33  Score=16.01  Aligned_cols=16  Identities=44%  Similarity=0.682  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||+|+..+.
T Consensus        13 vG~~~vGKSsLi~~l~   28 (171)
T 1upt_A           13 LGLDGAGKTTILYRLQ   28 (171)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999997


No 107
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*
Probab=20.91  E-value=34  Score=15.96  Aligned_cols=15  Identities=53%  Similarity=0.671  Sum_probs=11.6

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|++-|||||+-.++
T Consensus        11 ~G~~GsGKSTia~~L   25 (179)
T 2pez_A           11 TGLSGAGKTTVSMAL   25 (179)
T ss_dssp             ECCTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899998999999999


No 108
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A
Probab=20.88  E-value=25  Score=16.64  Aligned_cols=16  Identities=38%  Similarity=0.478  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|...+|||+|+.++.
T Consensus         9 lG~~~vGKTSli~~~~   24 (170)
T 1g16_A            9 IGDSGVGKSCLLVRFV   24 (170)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999968899999998


No 109
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C*
Probab=20.65  E-value=26  Score=16.59  Aligned_cols=13  Identities=46%  Similarity=0.795  Sum_probs=6.6

Q ss_pred             CCCCCCHHHHHHH
Q ss_conf             7454450268999
Q gi|254781089|r    2 GLSESGKTTLLEA   14 (80)
Q Consensus         2 glsesgkttllea   14 (80)
                      |-+||||+|++.-
T Consensus        47 G~geSGKSTi~KQ   59 (402)
T 1azs_C           47 GAGESGKSTIVKQ   59 (402)
T ss_dssp             ESTTSSHHHHHHH
T ss_pred             CCCCCCHHHHHHH
T ss_conf             8998879999999


No 110
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori 26695} PDB: 1zui_A* 3hr7_A
Probab=20.54  E-value=30  Score=16.25  Aligned_cols=15  Identities=33%  Similarity=0.694  Sum_probs=11.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+-|||||+-..+
T Consensus        13 iG~~GsGKSTvak~L   27 (168)
T 1zuh_A           13 IGFMGSGKSSLAQEL   27 (168)
T ss_dssp             ESCTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999899999999


No 111
>2p67_A LAO/AO transport system kinase; ARGK, structural genomics, PSI-2, protein structure initiative; 1.80A {Escherichia coli K12} SCOP: c.37.1.10
Probab=20.43  E-value=43  Score=15.42  Aligned_cols=34  Identities=35%  Similarity=0.489  Sum_probs=21.2

Q ss_pred             CCCCCCHHHHHHHHHHHH--HHHHH-EECCCCEEEEE
Q ss_conf             745445026899998743--43210-12388124676
Q gi|254781089|r    2 GLSESGKTTLLEAIFLFG--EALAL-ALSNDPVSVFL   35 (80)
Q Consensus         2 glsesgkttlleaiflfg--ealal-alsndpvsvfl   35 (80)
                      |..-+||+||++++-..-  ....+ .+..||.|.+-
T Consensus        63 G~PGaGKSTLi~~L~~~~~~~~~~vavlavDpss~~s   99 (341)
T 2p67_A           63 GTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVT   99 (341)
T ss_dssp             ECTTSCHHHHHHHHHHHHHHTTCCEEEEEECCC----
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             8999989999999999986168860144168866402


No 112
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2
Probab=20.36  E-value=30  Score=16.24  Aligned_cols=15  Identities=27%  Similarity=0.446  Sum_probs=12.4

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+-+||||+-+++
T Consensus        10 ~G~~GsGKSTv~k~L   24 (173)
T 1kag_A           10 VGPMGAGKSTIGRQL   24 (173)
T ss_dssp             ECCTTSCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999889999999


No 113
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A
Probab=20.16  E-value=29  Score=16.34  Aligned_cols=19  Identities=37%  Similarity=0.662  Sum_probs=14.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             974544502689999874343
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEA   21 (80)
Q Consensus         1 mglsesgkttlleaiflfgea   21 (80)
                      +|.+.+||+||+.+++  |+.
T Consensus        10 vG~~nvGKSSLin~l~--~~~   28 (172)
T 2gj8_A           10 AGRPNAGKSSLLNALA--GRE   28 (172)
T ss_dssp             EESTTSSHHHHHHHHH--TSC
T ss_pred             ECCCCCCHHHHHHHHH--CCC
T ss_conf             9989999999999996--888


No 114
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A
Probab=20.13  E-value=39  Score=15.65  Aligned_cols=16  Identities=38%  Similarity=0.592  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||||+.++.
T Consensus        11 vG~~nvGKStLin~l~   26 (258)
T 3a1s_A           11 AGCPNVGKTSLFNALT   26 (258)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999998999999995


No 115
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, ATP-binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus VF5}
Probab=20.11  E-value=36  Score=15.82  Aligned_cols=15  Identities=40%  Similarity=0.711  Sum_probs=12.4

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |..-|||||+.+.+-
T Consensus         7 G~~GsGKsT~~~~L~   21 (195)
T 2pbr_A            7 GIDGSGKTTQAKKLY   21 (195)
T ss_dssp             CSTTSCHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             899898999999999


Done!