Query         gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 80
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:24:54 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781089.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1np6a_ c.37.1.10 (A:) Molybdo  78.9    0.38 2.8E-05   25.1   1.6   17    1-17      8-24  (170)
  2 d1xjca_ c.37.1.10 (A:) Molybdo  77.3    0.38 2.8E-05   25.1   1.2   16    1-16      7-22  (165)
  3 g1xew.1 c.37.1.12 (X:,Y:) Smc   75.3    0.66 4.8E-05   23.8   1.9   19    2-20     33-52  (329)
  4 g1f2t.1 c.37.1.12 (A:,B:) Rad5  73.2    0.71 5.1E-05   23.6   1.7   20    2-21     30-51  (292)
  5 g1ii8.1 c.37.1.12 (A:,B:) Rad5  71.3     0.9 6.5E-05   23.1   1.9   16    2-17     30-45  (369)
  6 d1qhla_ c.37.1.12 (A:) Cell di  64.0     1.2 8.7E-05   22.4   1.3   19    2-20     31-51  (222)
  7 d1m7ga_ c.37.1.4 (A:) Adenosin  60.4     1.8 0.00013   21.5   1.7   16    1-16     30-45  (208)
  8 d2bv3a2 c.37.1.8 (A:7-282) Elo  60.2     1.5 0.00011   21.9   1.2   23    1-23     12-34  (276)
  9 d1w1wa_ c.37.1.12 (A:) Smc hea  58.3     2.2 0.00016   21.0   1.8   18    2-19     32-50  (427)
 10 d1l2ta_ c.37.1.12 (A:) MJ0796   51.3     2.5 0.00018   20.7   1.2   17    1-17     37-53  (230)
 11 d1ly1a_ c.37.1.1 (A:) Polynucl  50.4     3.2 0.00023   20.2   1.6   16    1-16      8-23  (152)
 12 d1e69a_ c.37.1.12 (A:) Smc hea  49.9       6 0.00044   18.7   2.9   16    2-17     31-46  (308)
 13 d3dhwc1 c.37.1.12 (C:1-240) Me  44.4     3.3 0.00024   20.1   0.9   18    1-18     37-54  (240)
 14 d2dy1a2 c.37.1.8 (A:8-274) Elo  44.2     3.9 0.00028   19.7   1.2   21    1-21      8-28  (267)
 15 d2awna2 c.37.1.12 (A:4-235) Ma  44.0     3.9 0.00028   19.7   1.2   17    1-17     32-48  (232)
 16 d1bifa1 c.37.1.7 (A:37-249) 6-  43.1     4.1  0.0003   19.6   1.2   16    1-16      8-23  (213)
 17 d1mkya1 c.37.1.8 (A:2-172) Pro  42.8     4.4 0.00032   19.4   1.4   16    1-16      6-21  (171)
 18 d1g2912 c.37.1.12 (1:1-240) Ma  42.7     4.2  0.0003   19.5   1.2   17    1-17     35-51  (240)
 19 d2olra1 c.91.1.1 (A:228-540) P  42.5     3.6 0.00026   19.9   0.9   12    1-12     20-31  (313)
 20 d1ii2a1 c.91.1.1 (A:201-523) P  41.9     3.8 0.00027   19.8   0.9   12    1-12     20-31  (323)
 21 d1l7vc_ c.37.1.12 (C:) ABC tra  40.6     5.3 0.00038   19.0   1.5   16    1-16     31-46  (231)
 22 d1b0ua_ c.37.1.12 (A:) ATP-bin  40.1     5.7 0.00041   18.8   1.6   17    1-17     34-50  (258)
 23 d1oxxk2 c.37.1.12 (K:1-242) Gl  39.3     3.4 0.00025   20.0   0.3   18    1-18     37-54  (242)
 24 d1yrba1 c.37.1.10 (A:1-244) AT  39.3       6 0.00043   18.7   1.6   15    2-16      7-21  (244)
 25 d1v43a3 c.37.1.12 (A:7-245) Hy  38.4     5.3 0.00039   19.0   1.2   18    1-18     38-55  (239)
 26 d1knqa_ c.37.1.17 (A:) Glucona  38.3     5.3 0.00039   19.0   1.2   15    1-15     12-26  (171)
 27 d1nrjb_ c.37.1.8 (B:) Signal r  38.1     5.4 0.00039   18.9   1.2   16    1-16      9-24  (209)
 28 d1vpla_ c.37.1.12 (A:) Putativ  38.0     5.4  0.0004   18.9   1.2   18    1-18     34-51  (238)
 29 d1m8pa3 c.37.1.15 (A:391-573)   37.8     6.5 0.00047   18.5   1.6   15    1-15     12-26  (183)
 30 d1egaa1 c.37.1.8 (A:4-182) GTP  37.5     6.1 0.00044   18.7   1.4   16    1-16     11-26  (179)
 31 d2pmka1 c.37.1.12 (A:467-707)   37.2     5.7 0.00042   18.8   1.2   18    1-18     35-52  (241)
 32 d1j3ba1 c.91.1.1 (A:212-529) P  36.8     4.4 0.00032   19.4   0.6   12    1-12     20-31  (318)
 33 d1f6ba_ c.37.1.8 (A:) SAR1 {Ch  36.5     4.9 0.00036   19.1   0.8   16    1-16     19-34  (186)
 34 d1nija1 c.37.1.10 (A:2-223) Hy  36.3     6.2 0.00045   18.6   1.2   16    2-17     10-25  (222)
 35 d1sgwa_ c.37.1.12 (A:) Putativ  36.1     6.1 0.00044   18.7   1.2   16    1-16     33-48  (200)
 36 d1r0wa_ c.37.1.12 (A:) Cystic   35.9     5.4 0.00039   18.9   0.9   17    1-17     68-84  (281)
 37 d2onka1 c.37.1.12 (A:1-240) Mo  34.6     6.6 0.00048   18.5   1.2   17    1-17     30-46  (240)
 38 d1g7sa4 c.37.1.8 (A:1-227) Ini  34.5     6.7 0.00049   18.4   1.2   17    1-17     11-27  (227)
 39 d1yj5a2 c.37.1.1 (A:351-522) 5  34.5     6.2 0.00045   18.6   1.0   16    1-16     20-35  (172)
 40 d1ye8a1 c.37.1.11 (A:1-178) Hy  34.4     7.9 0.00058   18.0   1.6   16    2-17      7-22  (178)
 41 d2c78a3 c.37.1.8 (A:9-212) Elo  34.2     7.3 0.00053   18.2   1.4   18    1-18      9-26  (204)
 42 d2vp4a1 c.37.1.1 (A:12-208) De  33.9     5.1 0.00037   19.1   0.5   15    2-16     16-30  (197)
 43 d1jj7a_ c.37.1.12 (A:) Peptide  33.8       7 0.00051   18.3   1.2   18    1-18     46-63  (251)
 44 d1ji0a_ c.37.1.12 (A:) Branche  33.8     6.5 0.00047   18.5   1.0   18    1-18     38-55  (240)
 45 d3d31a2 c.37.1.12 (A:1-229) Su  33.8     5.3 0.00039   19.0   0.6   17    1-17     32-48  (229)
 46 d2fh5b1 c.37.1.8 (B:63-269) Si  33.6     7.6 0.00055   18.1   1.4   16    1-16      6-21  (207)
 47 d1g6oa_ c.37.1.11 (A:) Hexamer  32.9     8.4 0.00061   17.9   1.5   17    2-18    173-189 (323)
 48 d1rz3a_ c.37.1.6 (A:) Hypothet  32.7     7.7 0.00056   18.1   1.3   16    2-17     29-44  (198)
 49 d1qhxa_ c.37.1.3 (A:) Chloramp  32.1     9.1 0.00067   17.7   1.6   15    1-15      9-23  (178)
 50 d1g6ha_ c.37.1.12 (A:) MJ1267   31.8     7.3 0.00053   18.2   1.0   18    1-18     36-53  (254)
 51 d1f60a3 c.37.1.8 (A:2-240) Elo  31.5     7.8 0.00056   18.1   1.1   19    1-19     12-30  (239)
 52 d1azta2 c.37.1.8 (A:35-65,A:20  31.4     9.2 0.00067   17.7   1.5   19    1-20     12-30  (221)
 53 d1mkya2 c.37.1.8 (A:173-358) P  30.9     8.9 0.00065   17.8   1.4   21    1-23     14-34  (186)
 54 d1zd9a1 c.37.1.8 (A:18-181) AD  30.7     8.5 0.00062   17.9   1.2   16    1-16      8-23  (164)
 55 d1lw7a2 c.37.1.1 (A:220-411) T  30.3     7.4 0.00054   18.2   0.9   16    1-16     13-28  (192)
 56 d1mv5a_ c.37.1.12 (A:) Multidr  30.3     8.7 0.00063   17.8   1.2   18    1-18     34-51  (242)
 57 d1upta_ c.37.1.8 (A:) ADP-ribo  30.2      10 0.00075   17.4   1.6   16    1-16     11-26  (169)
 58 d3b60a1 c.37.1.12 (A:329-581)   30.1     7.7 0.00056   18.1   0.9   18    1-18     47-64  (253)
 59 d1tg7a3 b.18.1.27 (A:849-1011)  29.9      14 0.00099   16.8   2.2   43   17-59     13-55  (163)
 60 d1rkba_ c.37.1.1 (A:) Adenylat  28.9     9.4 0.00069   17.6   1.2   16    1-16     10-25  (173)
 61 d1svia_ c.37.1.8 (A:) Probable  28.7     9.1 0.00066   17.7   1.1   16    1-16     29-44  (195)
 62 d2bdta1 c.37.1.25 (A:1-176) Hy  28.3      12 0.00084   17.2   1.6   38    1-48      8-45  (176)
 63 d1zj6a1 c.37.1.8 (A:2-178) ADP  28.1     8.8 0.00064   17.8   0.9   16    1-16     21-36  (177)
 64 d1udxa2 c.37.1.8 (A:157-336) O  27.1      11 0.00077   17.4   1.2   15    1-15      7-21  (180)
 65 d1jnya3 c.37.1.8 (A:4-227) Elo  26.8      11 0.00079   17.3   1.2   16    2-17     10-25  (224)
 66 d1x6va3 c.37.1.4 (A:34-228) Ad  26.4       9 0.00065   17.8   0.7   15    1-15     25-39  (195)
 67 d2fu5c1 c.37.1.8 (C:3-175) Rab  26.0     6.9 0.00051   18.4   0.1   16    1-16     12-27  (173)
 68 d1y63a_ c.37.1.1 (A:) Probable  25.4      12 0.00087   17.1   1.2   15    1-15     11-25  (174)
 69 d1ksha_ c.37.1.8 (A:) ADP-ribo  25.3      12 0.00088   17.1   1.2   15    1-15      8-22  (165)
 70 d1e0sa_ c.37.1.8 (A:) ADP-ribo  25.3     7.9 0.00058   18.1   0.3   15    1-15     18-32  (173)
 71 d1zcba2 c.37.1.8 (A:47-75,A:20  24.5      13 0.00092   17.0   1.2   20    1-21      8-27  (200)
 72 d1khta_ c.37.1.1 (A:) Adenylat  24.3      15  0.0011   16.5   1.6   15    2-16      8-22  (190)
 73 d2gj8a1 c.37.1.8 (A:216-376) P  24.1      12 0.00089   17.0   1.1   16    1-16      7-22  (161)
 74 d3raba_ c.37.1.8 (A:) Rab3a {R  23.9      13 0.00097   16.9   1.2   16    1-16     11-26  (169)
 75 d1wf3a1 c.37.1.8 (A:3-180) GTP  23.7      14   0.001   16.7   1.4   16    1-16     11-26  (178)
 76 d1zp6a1 c.37.1.25 (A:6-181) Hy  23.5      12 0.00087   17.1   0.9   15    1-15     10-24  (176)
 77 d1n0ua2 c.37.1.8 (A:3-343) Elo  23.4      14  0.0011   16.7   1.3   20    1-20     23-42  (341)
 78 d1kk1a3 c.37.1.8 (A:6-200) Ini  23.2      14   0.001   16.7   1.2   15    2-16     12-26  (195)
 79 d1r5ba3 c.37.1.8 (A:215-459) E  23.1      13 0.00095   16.9   1.0   17    1-17     30-46  (245)
 80 d1g16a_ c.37.1.8 (A:) Rab-rela  22.8      13 0.00092   17.0   0.9   15    1-15      8-22  (166)
 81 d2qtvb1 c.37.1.8 (B:24-189) SA  22.8      17  0.0012   16.3   1.6   19    1-20      6-24  (166)
 82 d1r8sa_ c.37.1.8 (A:) ADP-ribo  22.7      18  0.0013   16.1   1.7   16    1-16      6-21  (160)
 83 d1svsa1 c.37.1.8 (A:32-60,A:18  22.7      12  0.0009   17.0   0.8   19    1-20      8-26  (195)
 84 d2hyda1 c.37.1.12 (A:324-578)   22.6     8.5 0.00062   17.9   0.0   17    1-17     50-66  (255)
 85 d1moza_ c.37.1.8 (A:) ADP-ribo  22.6     9.6  0.0007   17.6   0.3   15    1-15     23-37  (182)
 86 d2bcjq2 c.37.1.8 (Q:38-66,Q:18  22.3      13 0.00095   16.9   0.9   19    1-20      8-26  (200)
 87 d2gf4a1 a.8.10.1 (A:1-89) Nypo  21.7     6.4 0.00047   18.5  -0.8   27    7-33     47-73  (89)
 88 d1kgda_ c.37.1.1 (A:) Guanylat  21.4      16  0.0012   16.4   1.3   27    1-27      9-36  (178)
 89 d2cxxa1 c.37.1.8 (A:2-185) GTP  21.4      15  0.0011   16.5   1.1   26    1-30      6-31  (184)
 90 d1lnza2 c.37.1.8 (A:158-342) O  21.4      12 0.00085   17.1   0.5   16    1-16      7-22  (185)
 91 d2i3ba1 c.37.1.11 (A:1-189) Ca  21.0      20  0.0014   15.9   1.6   15    2-16      8-22  (189)
 92 d1fzqa_ c.37.1.8 (A:) ADP-ribo  20.8      15  0.0011   16.6   0.9   15    1-15     22-36  (176)
 93 d1gsia_ c.37.1.1 (A:) Thymidyl  20.5      20  0.0015   15.9   1.6   15    2-16      7-21  (208)
 94 d2qn6a3 c.37.1.8 (A:2-206) Ini  20.1      18  0.0013   16.2   1.2   15    2-16     15-29  (205)
 95 d1uj2a_ c.37.1.6 (A:) Uridine-  20.0      21  0.0015   15.8   1.6   15    2-16      9-23  (213)

No 1  
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}
Probab=78.85  E-value=0.38  Score=25.08  Aligned_cols=17  Identities=41%  Similarity=0.532  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|.+-||||||++.+--
T Consensus         8 tG~~GSGKTTL~~~L~~   24 (170)
T d1np6a_           8 AAWSGTGKTTLLKKLIP   24 (170)
T ss_dssp             ECCTTSCHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHH
T ss_conf             91899989999999999


No 2  
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}
Probab=77.27  E-value=0.38  Score=25.06  Aligned_cols=16  Identities=50%  Similarity=0.708  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+-||||||++.+-
T Consensus         7 ~G~~gSGKTTli~~l~   22 (165)
T d1xjca_           7 VGYKHSGKTTLMEKWV   22 (165)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHH
T ss_conf             8099998999999999


No 3  
>g1xew.1 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]}
Probab=75.26  E-value=0.66  Score=23.82  Aligned_cols=19  Identities=37%  Similarity=0.677  Sum_probs=14.8

Q ss_pred             CCCCCCHHHHHHHHH-HHHH
Q ss_conf             745445026899998-7434
Q gi|254781089|r    2 GLSESGKTTLLEAIF-LFGE   20 (80)
Q Consensus         2 glsesgkttlleaif-lfge   20 (80)
                      |-..||||++|+||. ++|+
T Consensus        33 G~NGsGKS~il~AI~~~L~~   52 (329)
T g1xew.1          33 GANGSGKSNIGDAILFVLGG   52 (329)
T ss_dssp             ECTTSSSHHHHHHHHHHTTS
T ss_pred             CCCCCCHHHHHHHHHHHHCC
T ss_conf             99998899999999999778


No 4  
>g1f2t.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=73.21  E-value=0.71  Score=23.65  Aligned_cols=20  Identities=45%  Similarity=0.710  Sum_probs=15.7

Q ss_pred             CCCCCCHHHHHHHHH--HHHHH
Q ss_conf             745445026899998--74343
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGEA   21 (80)
Q Consensus         2 glsesgkttlleaif--lfgea   21 (80)
                      |-+.|||||+|+||.  ||+..
T Consensus        30 G~NGsGKStiL~Ai~~~l~~~~   51 (292)
T g1f2t.1          30 GQNGSGKSSLLDAILVGLYWPL   51 (292)
T ss_dssp             CCTTSSHHHHHHHHHHHHHCSS
T ss_pred             CCCCCCHHHHHHHHHHHHCCCC
T ss_conf             8899889999999999855776


No 5  
>g1ii8.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=71.30  E-value=0.9  Score=23.10  Aligned_cols=16  Identities=50%  Similarity=0.854  Sum_probs=13.9

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-..|||||+||||.+
T Consensus        30 G~NgsGKTtileAI~~   45 (369)
T g1ii8.1          30 GQNGSGKSSLLDAILV   45 (369)
T ss_dssp             CCTTSSHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             7899999999999999


No 6  
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}
Probab=64.02  E-value=1.2  Score=22.44  Aligned_cols=19  Identities=32%  Similarity=0.497  Sum_probs=15.1

Q ss_pred             CCCCCCHHHHHHHHH--HHHH
Q ss_conf             745445026899998--7434
Q gi|254781089|r    2 GLSESGKTTLLEAIF--LFGE   20 (80)
Q Consensus         2 glsesgkttlleaif--lfge   20 (80)
                      |-..|||||+|+||.  |+|.
T Consensus        31 G~NGsGKStil~Ai~~~L~g~   51 (222)
T d1qhla_          31 GGNGAGKSTTMAAFVTALIPD   51 (222)
T ss_dssp             SCCSHHHHHHHHHHHHHHSCC
T ss_pred             CCCCCCHHHHHHHHHHHHCCC
T ss_conf             899998799999999996687


No 7  
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
Probab=60.44  E-value=1.8  Score=21.47  Aligned_cols=16  Identities=50%  Similarity=0.584  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|||-|||||+-.++.
T Consensus        30 tGlsGsGKTTia~~L~   45 (208)
T d1m7ga_          30 TGLSASGKSTLAVELE   45 (208)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999899999999


No 8  
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
Probab=60.20  E-value=1.5  Score=21.90  Aligned_cols=23  Identities=26%  Similarity=0.374  Sum_probs=18.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             97454450268999987434321
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALA   23 (80)
Q Consensus         1 mglsesgkttlleaiflfgeala   23 (80)
                      +|-..+|||||.|++.....+..
T Consensus        12 ~gh~~~GKTtL~e~ll~~~g~~~   34 (276)
T d2bv3a2          12 AAHIDAGKTTTTERILYYTGRIH   34 (276)
T ss_dssp             EECTTSCHHHHHHHHHHHHTSSC
T ss_pred             EECCCCCHHHHHHHHHHHCCCCC
T ss_conf             95898998999999999648534


No 9  
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=58.26  E-value=2.2  Score=21.04  Aligned_cols=18  Identities=39%  Similarity=0.754  Sum_probs=14.1

Q ss_pred             CCCCCCHHHHHHHHH-HHH
Q ss_conf             745445026899998-743
Q gi|254781089|r    2 GLSESGKTTLLEAIF-LFG   19 (80)
Q Consensus         2 glsesgkttlleaif-lfg   19 (80)
                      |-.-||||++||||. .+|
T Consensus        32 G~NGsGKS~ileAi~~~lg   50 (427)
T d1w1wa_          32 GPNGSGKSNMMDAISFVLG   50 (427)
T ss_dssp             CSTTSSHHHHHHHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHHHC
T ss_conf             9999988999999999857


No 10 
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=51.33  E-value=2.5  Score=20.69  Aligned_cols=17  Identities=53%  Similarity=0.593  Sum_probs=13.9

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-||||||+..|--
T Consensus        37 iG~sGsGKSTLl~~i~g   53 (230)
T d1l2ta_          37 MGPSGSGKSTMLNIIGC   53 (230)
T ss_dssp             ECSTTSSHHHHHHHHTT
T ss_pred             ECCCCCCCCHHHHHCCC
T ss_conf             88999982165575068


No 11 
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}
Probab=50.41  E-value=3.2  Score=20.18  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|++-|||||+..++.
T Consensus         8 ~G~pGsGKTTla~~L~   23 (152)
T d1ly1a_           8 IGCPGSGKSTWAREFI   23 (152)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999999999999


No 12 
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}
Probab=49.86  E-value=6  Score=18.68  Aligned_cols=16  Identities=38%  Similarity=0.607  Sum_probs=13.5

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-..||||++|+||-+
T Consensus        31 G~NgsGKS~iL~Ai~~   46 (308)
T d1e69a_          31 GPNGSGKSNIIDAIKW   46 (308)
T ss_dssp             CCTTTCSTHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             9999848999999999


No 13 
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
Probab=44.37  E-value=3.3  Score=20.06  Aligned_cols=18  Identities=39%  Similarity=0.702  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-||||||+..|.-.
T Consensus        37 iG~sGsGKSTLl~~i~Gl   54 (240)
T d3dhwc1          37 IGASGAGKSTLIRCVNLL   54 (240)
T ss_dssp             EESTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHCCC
T ss_conf             899989888999987588


No 14 
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
Probab=44.20  E-value=3.9  Score=19.68  Aligned_cols=21  Identities=48%  Similarity=0.545  Sum_probs=15.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             974544502689999874343
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEA   21 (80)
Q Consensus         1 mglsesgkttlleaiflfgea   21 (80)
                      +|-..+|||||.|++.....+
T Consensus         8 iGh~~~GKTtL~e~ll~~~g~   28 (267)
T d2dy1a2           8 VGHAGSGKTTLTEALLYKTGA   28 (267)
T ss_dssp             EESTTSSHHHHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHHHCCC
T ss_conf             948898099999999997097


No 15 
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=44.03  E-value=3.9  Score=19.71  Aligned_cols=17  Identities=47%  Similarity=0.514  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-||||||+..|.-
T Consensus        32 iGpsGsGKSTLl~~i~G   48 (232)
T d2awna2          32 VGPSGCGKSTLLRMIAG   48 (232)
T ss_dssp             ECCTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             98999829999999965


No 16 
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=43.13  E-value=4.1  Score=19.60  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|++-|||||+-.++-
T Consensus         8 ~GlpgsGKSTla~~L~   23 (213)
T d1bifa1           8 VGLPARGKTYISKKLT   23 (213)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999999999999


No 17 
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}
Probab=42.83  E-value=4.4  Score=19.39  Aligned_cols=16  Identities=31%  Similarity=0.615  Sum_probs=13.9

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus         6 iG~~n~GKSsLi~~L~   21 (171)
T d1mkya1           6 VGRPNVGKSTLFNKLV   21 (171)
T ss_dssp             ECCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999998999999996


No 18 
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}
Probab=42.71  E-value=4.2  Score=19.54  Aligned_cols=17  Identities=47%  Similarity=0.454  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-||||||+..|.-
T Consensus        35 iG~sGaGKSTll~~i~g   51 (240)
T d1g2912          35 LGPSGCGKTTTLRMIAG   51 (240)
T ss_dssp             ECSTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             99999809999999964


No 19 
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
Probab=42.52  E-value=3.6  Score=19.86  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=10.1

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus        20 FGLSGTGKTTLs   31 (313)
T d2olra1          20 FGLSGTGKTTLS   31 (313)
T ss_dssp             ECSTTSSHHHHH
T ss_pred             ECCCCCCCCCCE
T ss_conf             704779856023


No 20 
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]}
Probab=41.93  E-value=3.8  Score=19.78  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=10.4

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus        20 FGLSGTGKTTLs   31 (323)
T d1ii2a1          20 FGLSGTGKTTLS   31 (323)
T ss_dssp             ECCTTSSHHHHH
T ss_pred             ECCCCCCCCCCE
T ss_conf             736778812051


No 21 
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}
Probab=40.56  E-value=5.3  Score=18.99  Aligned_cols=16  Identities=38%  Similarity=0.594  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+-+|||||+..|.
T Consensus        31 iG~nGaGKSTLl~~l~   46 (231)
T d1l7vc_          31 VGPNGAGKSTLLARMA   46 (231)
T ss_dssp             BCCTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9899980999999994


No 22 
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}
Probab=40.08  E-value=5.7  Score=18.81  Aligned_cols=17  Identities=47%  Similarity=0.671  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|.|-||||||+.+|.-
T Consensus        34 iG~sGsGKSTLl~~i~G   50 (258)
T d1b0ua_          34 IGSSGSGKSTFLRCINF   50 (258)
T ss_dssp             ECCTTSSHHHHHHHHTT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             98999829999999974


No 23 
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=39.29  E-value=3.4  Score=20.00  Aligned_cols=18  Identities=39%  Similarity=0.521  Sum_probs=14.8

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-||||||+..|.-+
T Consensus        37 iG~sGsGKSTll~~i~gl   54 (242)
T d1oxxk2          37 LGPSGAGKTTFMRIIAGL   54 (242)
T ss_dssp             ECSCHHHHHHHHHHHHTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             989998099999999758


No 24 
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
Probab=39.27  E-value=6  Score=18.71  Aligned_cols=15  Identities=47%  Similarity=0.452  Sum_probs=13.0

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-.-||||||++++-
T Consensus         7 G~~GsGKTTLl~~ll   21 (244)
T d1yrba1           7 GTAGSGKTTLTGEFG   21 (244)
T ss_dssp             CSTTSSHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             189983999999999


No 25 
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
Probab=38.45  E-value=5.3  Score=18.97  Aligned_cols=18  Identities=44%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-+|||||+..|.-+
T Consensus        38 iGpsGaGKSTLl~~i~Gl   55 (239)
T d1v43a3          38 LGPSGCGKTTTLRMIAGL   55 (239)
T ss_dssp             ECCTTSSHHHHHHHHHTS
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998299999999758


No 26 
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}
Probab=38.28  E-value=5.3  Score=18.96  Aligned_cols=15  Identities=40%  Similarity=0.714  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+-|||||+..++
T Consensus        12 ~G~~GsGKsT~a~~L   26 (171)
T d1knqa_          12 MGVSGSGKSAVASEV   26 (171)
T ss_dssp             ECSTTSCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899998989999999


No 27 
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=38.08  E-value=5.4  Score=18.93  Aligned_cols=16  Identities=44%  Similarity=0.584  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||||+.++.
T Consensus         9 vG~~n~GKTSLln~l~   24 (209)
T d1nrjb_           9 AGPQNSGKTSLLTLLT   24 (209)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999988999999996


No 28 
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}
Probab=38.02  E-value=5.4  Score=18.91  Aligned_cols=18  Identities=39%  Similarity=0.501  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|.+-+|||||+..|.=+
T Consensus        34 vG~nGaGKSTLl~~l~G~   51 (238)
T d1vpla_          34 IGPNGAGKTTTLRIISTL   51 (238)
T ss_dssp             ECCTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999999999999999669


No 29 
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
Probab=37.76  E-value=6.5  Score=18.50  Aligned_cols=15  Identities=33%  Similarity=0.563  Sum_probs=11.7

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|+|-|||||+-.++
T Consensus        12 ~G~~GsGKTTia~~L   26 (183)
T d1m8pa3          12 TGYMNSGKDAIARAL   26 (183)
T ss_dssp             ECSTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999999999999


No 30 
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=37.48  E-value=6.1  Score=18.66  Aligned_cols=16  Identities=38%  Similarity=0.696  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.+++
T Consensus        11 iG~~nvGKSSLin~L~   26 (179)
T d1egaa1          11 VGRPNVGKSTLLNKLL   26 (179)
T ss_dssp             ECSSSSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9799998999999995


No 31 
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}
Probab=37.20  E-value=5.7  Score=18.81  Aligned_cols=18  Identities=50%  Similarity=0.599  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||+||+..|.-+
T Consensus        35 vG~sGsGKSTLl~ll~gl   52 (241)
T d2pmka1          35 VGRSGSGKSTLTKLIQRF   52 (241)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHHC
T ss_conf             999999899999999735


No 32 
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
Probab=36.83  E-value=4.4  Score=19.40  Aligned_cols=12  Identities=67%  Similarity=0.883  Sum_probs=9.7

Q ss_pred             CCCCCCCHHHHH
Q ss_conf             974544502689
Q gi|254781089|r    1 MGLSESGKTTLL   12 (80)
Q Consensus         1 mglsesgkttll   12 (80)
                      .|||-+|||||-
T Consensus        20 fGLSGTGKTTLs   31 (318)
T d1j3ba1          20 FGLSGTGKTTLS   31 (318)
T ss_dssp             EECTTSCHHHHT
T ss_pred             ECCCCCCCCCCC
T ss_conf             736879814221


No 33 
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
Probab=36.50  E-value=4.9  Score=19.15  Aligned_cols=16  Identities=50%  Similarity=0.789  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||||+.++.
T Consensus        19 vG~~~vGKTsLl~~l~   34 (186)
T d1f6ba_          19 LGLDNAGKTTLLHMLK   34 (186)
T ss_dssp             EEETTSSHHHHHHHHS
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999996


No 34 
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=36.28  E-value=6.2  Score=18.63  Aligned_cols=16  Identities=50%  Similarity=0.671  Sum_probs=12.8

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |.-.|||||||..+.-
T Consensus        10 GFLGaGKTTll~~lL~   25 (222)
T d1nija1          10 GFLGAGKTTLLRHILN   25 (222)
T ss_dssp             ESSSSSCHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             4888999999999985


No 35 
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}
Probab=36.10  E-value=6.1  Score=18.65  Aligned_cols=16  Identities=50%  Similarity=0.565  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|-+-+|||||+..|.
T Consensus        33 ~G~NGsGKSTLl~~i~   48 (200)
T d1sgwa_          33 HGPNGIGKTTLLKTIS   48 (200)
T ss_dssp             ECCTTSSHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             9999971999999996


No 36 
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
Probab=35.87  E-value=5.4  Score=18.93  Aligned_cols=17  Identities=47%  Similarity=0.530  Sum_probs=13.8

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|-|-||||||+..|.=
T Consensus        68 vG~nGsGKSTLl~~i~G   84 (281)
T d1r0wa_          68 TGSTGSGKTSLLMLILG   84 (281)
T ss_dssp             EESTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             98999829999999957


No 37 
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=34.64  E-value=6.6  Score=18.45  Aligned_cols=17  Identities=35%  Similarity=0.509  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-+|||||+..|.-
T Consensus        30 iGpnGaGKSTll~~i~G   46 (240)
T d2onka1          30 LGPTGAGKSVFLELIAG   46 (240)
T ss_dssp             ECCTTSSHHHHHHHHHT
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             97999809999999973


No 38 
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
Probab=34.53  E-value=6.7  Score=18.44  Aligned_cols=17  Identities=47%  Similarity=0.591  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-..+|||||++++.-
T Consensus        11 iGh~d~GKSTL~~~L~~   27 (227)
T d1g7sa4          11 LGHVDHGKTTLLDHIRG   27 (227)
T ss_dssp             ECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHH
T ss_conf             96998549999999982


No 39 
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
Probab=34.51  E-value=6.2  Score=18.61  Aligned_cols=16  Identities=25%  Similarity=0.646  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|++-|||||+...++
T Consensus        20 ~G~pGsGKST~a~~l~   35 (172)
T d1yj5a2          20 VGFPGAGKSTFIQEHL   35 (172)
T ss_dssp             ECCTTSSHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999998999999999


No 40 
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical  kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}
Probab=34.43  E-value=7.9  Score=18.05  Aligned_cols=16  Identities=44%  Similarity=0.524  Sum_probs=13.2

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-+-+|||||+.+|--
T Consensus         7 G~~G~GKSTLl~~i~~   22 (178)
T d1ye8a1           7 GEPGVGKTTLVKKIVE   22 (178)
T ss_dssp             CCTTSSHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH
T ss_conf             8999389999999981


No 41 
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
Probab=34.16  E-value=7.3  Score=18.23  Aligned_cols=18  Identities=39%  Similarity=0.543  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-..+|||||++++...
T Consensus         9 iGhvd~GKSTL~~~Ll~~   26 (204)
T d2c78a3           9 IGHVDHGKTTLTAALTYV   26 (204)
T ss_dssp             ECSTTSSHHHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHHH
T ss_conf             947898499999999998


No 42 
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
Probab=33.91  E-value=5.1  Score=19.06  Aligned_cols=15  Identities=47%  Similarity=0.428  Sum_probs=12.5

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |.+-|||||+++.+-
T Consensus        16 G~~GsGKTTl~~~L~   30 (197)
T d2vp4a1          16 GNIGSGKTTYLNHFE   30 (197)
T ss_dssp             CSTTSCHHHHHHTTG
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             999988899999999


No 43 
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=33.83  E-value=7  Score=18.35  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||+||+..|.-+
T Consensus        46 vG~sGsGKSTLl~li~gl   63 (251)
T d1jj7a_          46 VGPNGSGKSTVAALLQNL   63 (251)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999998499999998614


No 44 
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}
Probab=33.79  E-value=6.5  Score=18.51  Aligned_cols=18  Identities=44%  Similarity=0.528  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|.+-+|||||+.+|.=+
T Consensus        38 iGpnGaGKSTl~~~i~Gl   55 (240)
T d1ji0a_          38 IGANGAGKTTTLSAIAGL   55 (240)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999998599999999678


No 45 
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}
Probab=33.76  E-value=5.3  Score=18.96  Aligned_cols=17  Identities=41%  Similarity=0.503  Sum_probs=14.0

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      +|-|-+|||||+..|.-
T Consensus        32 iGpsGaGKSTll~~l~G   48 (229)
T d3d31a2          32 LGPTGAGKTLFLELIAG   48 (229)
T ss_dssp             ECCCTHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHC
T ss_conf             98999829999999964


No 46 
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
Probab=33.58  E-value=7.6  Score=18.15  Aligned_cols=16  Identities=44%  Similarity=0.760  Sum_probs=13.7

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|...+|||||+.++.
T Consensus         6 vG~~~~GKTsLl~~l~   21 (207)
T d2fh5b1           6 VGLCDSGKTLLFVRLL   21 (207)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999998


No 47 
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}
Probab=32.94  E-value=8.4  Score=17.92  Aligned_cols=17  Identities=47%  Similarity=0.683  Sum_probs=12.4

Q ss_pred             CCCCCCHHHHHHHHHHH
Q ss_conf             74544502689999874
Q gi|254781089|r    2 GLSESGKTTLLEAIFLF   18 (80)
Q Consensus         2 glsesgkttlleaiflf   18 (80)
                      |-..|||||++.|+.-+
T Consensus       173 G~tgSGKTT~l~al~~~  189 (323)
T d1g6oa_         173 GGTGSGKTTYIKSIMEF  189 (323)
T ss_dssp             ESTTSSHHHHHHHHGGG
T ss_pred             EECCCCCHHHHHHHHHH
T ss_conf             40356625789998653


No 48 
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}
Probab=32.69  E-value=7.7  Score=18.10  Aligned_cols=16  Identities=56%  Similarity=0.669  Sum_probs=13.4

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |.+.|||||+...+.-
T Consensus        29 G~~GSGKSTla~~L~~   44 (198)
T d1rz3a_          29 GLSRSGKTTLANQLSQ   44 (198)
T ss_dssp             ECTTSSHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             9887899999999999


No 49 
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}
Probab=32.05  E-value=9.1  Score=17.71  Aligned_cols=15  Identities=27%  Similarity=0.490  Sum_probs=12.4

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|.+-|||||+-.++
T Consensus         9 ~G~~GsGKsTva~~L   23 (178)
T d1qhxa_           9 NGGSSAGKSGIVRCL   23 (178)
T ss_dssp             ECCTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999989999999


No 50 
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=31.78  E-value=7.3  Score=18.23  Aligned_cols=18  Identities=44%  Similarity=0.650  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|.+-+|||||+..|.-+
T Consensus        36 iG~nGaGKSTLl~~i~Gl   53 (254)
T d1g6ha_          36 IGPNGSGKSTLINVITGF   53 (254)
T ss_dssp             ECSTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHCC
T ss_conf             999998499999999779


No 51 
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=31.53  E-value=7.8  Score=18.10  Aligned_cols=19  Identities=26%  Similarity=0.338  Sum_probs=15.1

Q ss_pred             CCCCCCCHHHHHHHHHHHH
Q ss_conf             9745445026899998743
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFG   19 (80)
Q Consensus         1 mglsesgkttlleaiflfg   19 (80)
                      +|-..+|||||.+++....
T Consensus        12 iGHvD~GKsTl~~~ll~~~   30 (239)
T d1f60a3          12 IGHVDSGKSTTTGHLIYKC   30 (239)
T ss_dssp             EECTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHHHC
T ss_conf             9478998999999999981


No 52 
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
Probab=31.40  E-value=9.2  Score=17.69  Aligned_cols=19  Identities=32%  Similarity=0.529  Sum_probs=14.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|++.+|||+++.... .++
T Consensus        12 lG~~~vGKTsll~~~~-~~~   30 (221)
T d1azta2          12 LGAGESGKSTIVKQMR-ILH   30 (221)
T ss_dssp             ECSTTSSHHHHHHHHH-HHH
T ss_pred             ECCCCCCHHHHHHHHH-CCC
T ss_conf             9899998899999895-098


No 53 
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}
Probab=30.88  E-value=8.9  Score=17.76  Aligned_cols=21  Identities=38%  Similarity=0.591  Sum_probs=15.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             97454450268999987434321
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALA   23 (80)
Q Consensus         1 mglsesgkttlleaiflfgeala   23 (80)
                      +|.+.+||+||+.++  .|+..+
T Consensus        14 iG~~~~GKSTLin~l--~~~~~~   34 (186)
T d1mkya2          14 VGRPNVGKSTLFNAI--LNKERA   34 (186)
T ss_dssp             ECSTTSSHHHHHHHH--HTSTTE
T ss_pred             ECCCCCCHHHHHHHH--HCCCCC
T ss_conf             999999999999999--778762


No 54 
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}
Probab=30.67  E-value=8.5  Score=17.90  Aligned_cols=16  Identities=50%  Similarity=0.692  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..+.
T Consensus         8 ~G~~~~GKTsLl~~l~   23 (164)
T d1zd9a1           8 VGLQYSGKTTFVNVIA   23 (164)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999997


No 55 
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}
Probab=30.34  E-value=7.4  Score=18.19  Aligned_cols=16  Identities=31%  Similarity=0.536  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+-+|||||..++-
T Consensus        13 ~G~~GsGKTTla~~La   28 (192)
T d1lw7a2          13 LGGESSGKSVLVNKLA   28 (192)
T ss_dssp             ECCTTSHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999998999999999


No 56 
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
Probab=30.29  E-value=8.7  Score=17.84  Aligned_cols=18  Identities=33%  Similarity=0.495  Sum_probs=14.5

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      +|-|-|||+||+..+.-+
T Consensus        34 vG~sGsGKSTLl~ll~gl   51 (242)
T d1mv5a_          34 AGPSGGGKSTIFSLLERF   51 (242)
T ss_dssp             ECCTTSSHHHHHHHHTTS
T ss_pred             ECCCCCCHHHHHHHHHHH
T ss_conf             999999799999999996


No 57 
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
Probab=30.18  E-value=10  Score=17.44  Aligned_cols=16  Identities=44%  Similarity=0.682  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||||+.++.
T Consensus        11 vG~~~vGKSSLi~~~~   26 (169)
T d1upta_          11 LGLDGAGKTTILYRLQ   26 (169)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989999999996


No 58 
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
Probab=30.08  E-value=7.7  Score=18.11  Aligned_cols=18  Identities=44%  Similarity=0.567  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHH
Q ss_conf             974544502689999874
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLF   18 (80)
Q Consensus         1 mglsesgkttlleaiflf   18 (80)
                      .|-|-|||+||+..+.-+
T Consensus        47 vG~sGsGKSTLl~ll~gl   64 (253)
T d3b60a1          47 VGRSGSGKSTIASLITRF   64 (253)
T ss_dssp             EECTTSSHHHHHHHHTTT
T ss_pred             ECCCCCHHHHHHHHHHCC
T ss_conf             999998599999998621


No 59 
>d1tg7a3 b.18.1.27 (A:849-1011) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]}
Probab=29.94  E-value=14  Score=16.79  Aligned_cols=43  Identities=21%  Similarity=0.428  Sum_probs=36.8

Q ss_pred             HHHHHHHHEECCCCEEEEEEHHHHCCCCCCCEEEEEEEEEEEE
Q ss_conf             7434321012388124676102202311343025766787511
Q gi|254781089|r   17 LFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDA   59 (80)
Q Consensus        17 lfgealalalsndpvsvflksdvfdgisknqygfftgkikvda   59 (80)
                      ||+|-....|..-|-|-.-.+.-++|+++---+||+-..+.|-
T Consensus        13 LyaER~GwHLPg~~~s~W~s~sp~~g~~~~gv~fy~T~f~L~l   55 (163)
T d1tg7a3          13 LYAERQGFHQPQPPTQKWDSSSPFTGLTKPGIRFYSTSFDLDL   55 (163)
T ss_dssp             SHHHHTTTTSSSCCCTTSBCCCTTTCBSSSEEEEEEEEEECCC
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCC
T ss_conf             6567503348888855555358667765796579987876478


No 60 
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}
Probab=28.91  E-value=9.4  Score=17.64  Aligned_cols=16  Identities=38%  Similarity=0.405  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+-|||||+..++-
T Consensus        10 ~G~pGsGKTTia~~La   25 (173)
T d1rkba_          10 TGTPGVGKTTLGKELA   25 (173)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999999899999999


No 61 
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
Probab=28.71  E-value=9.1  Score=17.72  Aligned_cols=16  Identities=25%  Similarity=0.609  Sum_probs=14.1

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+||+||+.++.
T Consensus        29 vG~~n~GKSTLin~L~   44 (195)
T d1svia_          29 AGRSNVGKSSFINSLI   44 (195)
T ss_dssp             EEBTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHC
T ss_conf             8999987999999852


No 62 
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}
Probab=28.33  E-value=12  Score=17.17  Aligned_cols=38  Identities=21%  Similarity=0.391  Sum_probs=20.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHEECCCCEEEEEEHHHHCCCCCCCE
Q ss_conf             974544502689999874343210123881246761022023113430
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQY   48 (80)
Q Consensus         1 mglsesgkttlleaiflfgealalalsndpvsvflksdvfdgisknqy   48 (80)
                      .|.+-|||||+..++-       -.+.   -.+++..|.+.....+.+
T Consensus         8 ~G~~GsGKTTva~~L~-------~~~~---~~~~~~~d~~~~~~~~~~   45 (176)
T d2bdta1           8 TGPAGVGKSTTCKRLA-------AQLD---NSAYIEGDIINHMVVGGY   45 (176)
T ss_dssp             ECSTTSSHHHHHHHHH-------HHSS---SEEEEEHHHHHTTCCTTC
T ss_pred             ECCCCCCHHHHHHHHH-------HHCC---CCEEEEHHHHHHHHHCCC
T ss_conf             8999999899999999-------9809---988983078899874566


No 63 
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}
Probab=28.08  E-value=8.8  Score=17.81  Aligned_cols=16  Identities=44%  Similarity=0.659  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++-
T Consensus        21 vG~~~~GKSsLi~rl~   36 (177)
T d1zj6a1          21 VGLDNAGKTTILYQFS   36 (177)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999996


No 64 
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}
Probab=27.08  E-value=11  Score=17.39  Aligned_cols=15  Identities=40%  Similarity=0.806  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||||+.++
T Consensus         7 vG~~nvGKSTLin~L   21 (180)
T d1udxa2           7 VGYPNAGKSSLLAAM   21 (180)
T ss_dssp             ECCGGGCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999899999999


No 65 
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=26.82  E-value=11  Score=17.31  Aligned_cols=16  Identities=31%  Similarity=0.667  Sum_probs=12.9

Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             7454450268999987
Q gi|254781089|r    2 GLSESGKTTLLEAIFL   17 (80)
Q Consensus         2 glsesgkttlleaifl   17 (80)
                      |-..+|||||+++++.
T Consensus        10 GHVd~GKTTL~~~Ll~   25 (224)
T d1jnya3          10 GHVDHGKSTLVGRLLM   25 (224)
T ss_dssp             ESTTSSHHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             4479999999999999


No 66 
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
Probab=26.37  E-value=9  Score=17.76  Aligned_cols=15  Identities=53%  Similarity=0.671  Sum_probs=12.3

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|++-|||||+-.++
T Consensus        25 ~G~pGSGKTTiAk~L   39 (195)
T d1x6va3          25 TGLSGAGKTTVSMAL   39 (195)
T ss_dssp             ESSCHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             899999999999999


No 67 
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}
Probab=25.99  E-value=6.9  Score=18.35  Aligned_cols=16  Identities=38%  Similarity=0.351  Sum_probs=13.4

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+.+..
T Consensus        12 vG~~~vGKTsLi~~l~   27 (173)
T d2fu5c1          12 IGDSGVGKTCVLFRFS   27 (173)
T ss_dssp             ECCCCC----------
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999949999999997


No 68 
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}
Probab=25.43  E-value=12  Score=17.10  Aligned_cols=15  Identities=40%  Similarity=0.625  Sum_probs=12.5

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+-|||||+...+
T Consensus        11 ~G~~GsGKTT~~~~L   25 (174)
T d1y63a_          11 TGTPGTGKTSMAEMI   25 (174)
T ss_dssp             ECSTTSSHHHHHHHH
T ss_pred             EECCCCCHHHHHHHH
T ss_conf             828999889999999


No 69 
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
Probab=25.29  E-value=12  Score=17.08  Aligned_cols=15  Identities=47%  Similarity=0.873  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||+|+..+
T Consensus         8 vG~~~~GKTsLi~~l   22 (165)
T d1ksha_           8 LGLDNAGKTTILKKF   22 (165)
T ss_dssp             ECSTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999998999999998


No 70 
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
Probab=25.25  E-value=7.9  Score=18.05  Aligned_cols=15  Identities=47%  Similarity=0.806  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||+|+..+
T Consensus        18 vG~~~vGKTSli~rl   32 (173)
T d1e0sa_          18 LGLDAAGKTTILYKL   32 (173)
T ss_dssp             EEETTSSHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999998789999998


No 71 
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
Probab=24.53  E-value=13  Score=16.96  Aligned_cols=20  Identities=35%  Similarity=0.549  Sum_probs=15.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             974544502689999874343
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEA   21 (80)
Q Consensus         1 mglsesgkttlleaiflfgea   21 (80)
                      .|.+.+|||+|+... -|.+.
T Consensus         8 lG~~~vGKTsll~r~-~f~~~   27 (200)
T d1zcba2           8 LGAGESGKSTFLKQM-RIIHG   27 (200)
T ss_dssp             ECSTTSSHHHHHHHH-HHHHS
T ss_pred             ECCCCCCHHHHHHHH-HCCCC
T ss_conf             989999989999988-46898


No 72 
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}
Probab=24.25  E-value=15  Score=16.54  Aligned_cols=15  Identities=27%  Similarity=0.353  Sum_probs=12.9

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |.+-|||||+...+.
T Consensus         8 G~~GsGKsT~~~~L~   22 (190)
T d1khta_           8 GVPGVGSTTSSQLAM   22 (190)
T ss_dssp             CCTTSCHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             999989899999999


No 73 
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}
Probab=24.13  E-value=12  Score=17.03  Aligned_cols=16  Identities=38%  Similarity=0.640  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+||+||+.++.
T Consensus         7 vG~~nvGKSsLin~l~   22 (161)
T d2gj8a1           7 AGRPNAGKSSLLNALA   22 (161)
T ss_dssp             EESTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999998999999996


No 74 
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=23.88  E-value=13  Score=16.85  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=13.2

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||+|+..+.
T Consensus        11 vG~~~vGKTsLi~~l~   26 (169)
T d3raba_          11 IGNSSVGKTSFLFRYA   26 (169)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999919899999997


No 75 
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}
Probab=23.74  E-value=14  Score=16.67  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=13.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.+++
T Consensus        11 vG~~~~GKSSLin~l~   26 (178)
T d1wf3a1          11 VGKPNVGKSTLLNNLL   26 (178)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999999999999996


No 76 
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}
Probab=23.48  E-value=12  Score=17.09  Aligned_cols=15  Identities=47%  Similarity=0.652  Sum_probs=12.2

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|.+-|||||+..++
T Consensus        10 ~G~~GsGKSTia~~L   24 (176)
T d1zp6a1          10 SGHPGSGKSTIAEAL   24 (176)
T ss_dssp             EECTTSCHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             889999889999999


No 77 
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=23.45  E-value=14  Score=16.65  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=15.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|-..+|||||.|++.....
T Consensus        23 iGhvd~GKTTL~d~Ll~~~g   42 (341)
T d1n0ua2          23 IAHVDHGKSTLTDSLVQRAG   42 (341)
T ss_dssp             ECCGGGTHHHHHHHHHHHHB
T ss_pred             EECCCCCHHHHHHHHHHHCC
T ss_conf             96888869999999999779


No 78 
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}
Probab=23.23  E-value=14  Score=16.74  Aligned_cols=15  Identities=47%  Similarity=0.620  Sum_probs=12.3

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |--.+||+||++++-
T Consensus        12 Ghvd~GKSTL~~~L~   26 (195)
T d1kk1a3          12 GHVDHGKTTLTKALT   26 (195)
T ss_dssp             CSTTSSHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHH
T ss_conf             345884999999997


No 79 
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
Probab=23.05  E-value=13  Score=16.89  Aligned_cols=17  Identities=35%  Similarity=0.595  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      ||-..+|||||++++..
T Consensus        30 iGHVD~GKSTL~~~Ll~   46 (245)
T d1r5ba3          30 IGHVDAGKSTLGGNILF   46 (245)
T ss_dssp             EECGGGTHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHH
T ss_conf             95279899999999999


No 80 
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=22.83  E-value=13  Score=16.98  Aligned_cols=15  Identities=40%  Similarity=0.508  Sum_probs=12.9

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||+|+..+
T Consensus         8 vG~~~vGKTSli~~l   22 (166)
T d1g16a_           8 IGDSGVGKSCLLVRF   22 (166)
T ss_dssp             EESTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999996789999999


No 81 
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=22.80  E-value=17  Score=16.29  Aligned_cols=19  Identities=42%  Similarity=0.641  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      .|.+.+|||+|+..+ ..++
T Consensus         6 iG~~nvGKSSLln~l-~~~~   24 (166)
T d2qtvb1           6 LGLDNAGKTTLLHML-KNDR   24 (166)
T ss_dssp             ECSTTSSHHHHHHHH-HHSC
T ss_pred             ECCCCCCHHHHHHHH-HCCC
T ss_conf             999999999999999-5899


No 82 
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
Probab=22.69  E-value=18  Score=16.11  Aligned_cols=16  Identities=44%  Similarity=0.663  Sum_probs=13.3

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      .|.+.+|||||+..+.
T Consensus         6 vG~~~vGKSsLi~~l~   21 (160)
T d1r8sa_           6 VGLDAAGKTTILYKLK   21 (160)
T ss_dssp             ECSTTSSHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             9999989899999996


No 83 
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=22.67  E-value=12  Score=17.01  Aligned_cols=19  Identities=32%  Similarity=0.531  Sum_probs=14.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|.+.+|||+++.. |..++
T Consensus         8 lG~~~vGKTsl~~r-~~~~~   26 (195)
T d1svsa1           8 LGAGESGKSTIVKQ-MKIIH   26 (195)
T ss_dssp             ECSTTSSHHHHHHH-HHHHH
T ss_pred             ECCCCCCHHHHHHH-HHHCC
T ss_conf             99999888999998-84089


No 84 
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
Probab=22.60  E-value=8.5  Score=17.88  Aligned_cols=17  Identities=41%  Similarity=0.610  Sum_probs=13.1

Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             97454450268999987
Q gi|254781089|r    1 MGLSESGKTTLLEAIFL   17 (80)
Q Consensus         1 mglsesgkttlleaifl   17 (80)
                      .|-|-|||+||+..|.-
T Consensus        50 vG~sGsGKSTLl~ll~g   66 (255)
T d2hyda1          50 VGMSGGGKSTLINLIPR   66 (255)
T ss_dssp             ECSTTSSHHHHHTTTTT
T ss_pred             ECCCCCCHHHHHHHHHH
T ss_conf             88999809999999971


No 85 
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}
Probab=22.55  E-value=9.6  Score=17.60  Aligned_cols=15  Identities=47%  Similarity=0.784  Sum_probs=12.6

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      +|.+.+|||||+..+
T Consensus        23 vG~~~vGKTsLi~~l   37 (182)
T d1moza_          23 LGLDGAGKTTILYRL   37 (182)
T ss_dssp             EEETTSSHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999999889999887


No 86 
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
Probab=22.32  E-value=13  Score=16.89  Aligned_cols=19  Identities=32%  Similarity=0.546  Sum_probs=14.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHH
Q ss_conf             97454450268999987434
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGE   20 (80)
Q Consensus         1 mglsesgkttlleaiflfge   20 (80)
                      +|.+.+|||+|+... ..++
T Consensus         8 lG~~~vGKTsll~r~-~~~~   26 (200)
T d2bcjq2           8 LGTGESGKSTFIKQM-RIIH   26 (200)
T ss_dssp             EESTTSSHHHHHHHH-HHHT
T ss_pred             ECCCCCCHHHHHHHH-HCCC
T ss_conf             999999889999999-6799


No 87 
>d2gf4a1 a.8.10.1 (A:1-89) Nypothetical protein Vng1086c {Halobacterium salinarium [TaxId: 2242]}
Probab=21.70  E-value=6.4  Score=18.52  Aligned_cols=27  Identities=44%  Similarity=0.603  Sum_probs=22.2

Q ss_pred             CHHHHHHHHHHHHHHHHHEECCCCEEE
Q ss_conf             502689999874343210123881246
Q gi|254781089|r    7 GKTTLLEAIFLFGEALALALSNDPVSV   33 (80)
Q Consensus         7 gkttlleaiflfgealalalsndpvsv   33 (80)
                      .|+---.|||+.|+++|-++|.++-|+
T Consensus        47 sK~eHk~AIF~L~~~Ia~~m~e~e~s~   73 (89)
T d2gf4a1          47 SKSEHKHAVFLLGNALAAAMSEDEFSS   73 (89)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             699999999999999999983123564


No 88 
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}
Probab=21.44  E-value=16  Score=16.37  Aligned_cols=27  Identities=11%  Similarity=0.337  Sum_probs=18.8

Q ss_pred             CCCCCCCHHHHHHHHH-HHHHHHHHEEC
Q ss_conf             9745445026899998-74343210123
Q gi|254781089|r    1 MGLSESGKTTLLEAIF-LFGEALALALS   27 (80)
Q Consensus         1 mglsesgkttlleaif-lfgealalals   27 (80)
                      +|-|-+||+||...+. .+.+.+..+.|
T Consensus         9 ~Gpsg~GK~tl~~~L~~~~~~~~~~~v~   36 (178)
T d1kgda_           9 LGAHGVGRRHIKNTLITKHPDRFAYPIP   36 (178)
T ss_dssp             ECCTTSSHHHHHHHHHHHCTTTEECCCC
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCEEECCC
T ss_conf             9989999999999999709767652300


No 89 
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}
Probab=21.44  E-value=15  Score=16.55  Aligned_cols=26  Identities=31%  Similarity=0.496  Sum_probs=17.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHEECCCC
Q ss_conf             974544502689999874343210123881
Q gi|254781089|r    1 MGLSESGKTTLLEAIFLFGEALALALSNDP   30 (80)
Q Consensus         1 mglsesgkttlleaiflfgealalalsndp   30 (80)
                      +|.+.+||+||+.++  +|+-.  +.++-|
T Consensus         6 vG~~nvGKSsLin~l--~~~~~--~~~~~~   31 (184)
T d2cxxa1           6 AGRSNVGKSTLIYRL--TGKKV--RRGKRP   31 (184)
T ss_dssp             EEBTTSSHHHHHHHH--HSCCC--SSSSST
T ss_pred             ECCCCCCHHHHHHHH--HCCCC--EEECCC
T ss_conf             999998899999999--68985--352789


No 90 
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
Probab=21.41  E-value=12  Score=17.14  Aligned_cols=16  Identities=38%  Similarity=0.671  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHH
Q ss_conf             9745445026899998
Q gi|254781089|r    1 MGLSESGKTTLLEAIF   16 (80)
Q Consensus         1 mglsesgkttlleaif   16 (80)
                      +|.+.+|||||+.++.
T Consensus         7 iG~~nvGKSSLin~L~   22 (185)
T d1lnza2           7 VGFPSVGKSTLLSVVS   22 (185)
T ss_dssp             ESSTTSSHHHHHHHSE
T ss_pred             ECCCCCCHHHHHHHHH
T ss_conf             8999987999999996


No 91 
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}
Probab=21.02  E-value=20  Score=15.95  Aligned_cols=15  Identities=40%  Similarity=0.465  Sum_probs=12.8

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-.-+|||||+.++.
T Consensus         8 G~~GtGKTtl~~~i~   22 (189)
T d2i3ba1           8 GPPGVGKTTLIHKAS   22 (189)
T ss_dssp             SCCSSCHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             899971999999999


No 92 
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}
Probab=20.80  E-value=15  Score=16.62  Aligned_cols=15  Identities=53%  Similarity=0.944  Sum_probs=12.6

Q ss_pred             CCCCCCCHHHHHHHH
Q ss_conf             974544502689999
Q gi|254781089|r    1 MGLSESGKTTLLEAI   15 (80)
Q Consensus         1 mglsesgkttlleai   15 (80)
                      .|.+.+|||+|+..+
T Consensus        22 vG~~~vGKSsLi~~l   36 (176)
T d1fzqa_          22 LGLDNAGKTTLLKQL   36 (176)
T ss_dssp             EESTTSSHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHH
T ss_conf             999998999999999


No 93 
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=20.48  E-value=20  Score=15.88  Aligned_cols=15  Identities=40%  Similarity=0.674  Sum_probs=12.5

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |..-|||||+.+.+.
T Consensus         7 G~dGsGKST~~~~L~   21 (208)
T d1gsia_           7 GVDGAGKRTLVEKLS   21 (208)
T ss_dssp             CSTTSSHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             998789999999999


No 94 
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
Probab=20.12  E-value=18  Score=16.20  Aligned_cols=15  Identities=53%  Similarity=0.727  Sum_probs=12.1

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |--.+|||||++++.
T Consensus        15 GhVd~GKSTL~~~L~   29 (205)
T d2qn6a3          15 GHVDHGKTTLVQAIT   29 (205)
T ss_dssp             CSTTSSHHHHHHHHH
T ss_pred             ECCCCCHHHHHHHHH
T ss_conf             724886999999997


No 95 
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=20.03  E-value=21  Score=15.80  Aligned_cols=15  Identities=33%  Similarity=0.505  Sum_probs=12.4

Q ss_pred             CCCCCCHHHHHHHHH
Q ss_conf             745445026899998
Q gi|254781089|r    2 GLSESGKTTLLEAIF   16 (80)
Q Consensus         2 glsesgkttlleaif   16 (80)
                      |-+-|||||+-.++.
T Consensus         9 G~~gSGKSTla~~L~   23 (213)
T d1uj2a_           9 GGTASGKSSVCAKIV   23 (213)
T ss_dssp             CSTTSSHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             999787999999999


Done!