RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* (A:136-512) Length = 377 Score = 27.6 bits (60), Expect = 0.66 Identities = 5/19 (26%), Positives = 9/19 (47%) Query: 1 MGLSESGKTTLLEAIFLFG 19 G + SG + + A+ L Sbjct: 38 AGTTGSGASVGVNAMILSM 56 >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii OT3} (A:) Length = 190 Score = 27.4 bits (59), Expect = 0.66 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G S GK+TL+ + Sbjct: 7 AGRSNVGKSTLIYRL 21 >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} (A:369-546) Length = 178 Score = 27.2 bits (59), Expect = 0.80 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 GL +GK+T+ E + Sbjct: 10 TGLPCAGKSTIAEILA 25 >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} (A:) Length = 192 Score = 27.4 bits (59), Expect = 0.81 Identities = 7/51 (13%), Positives = 13/51 (25%), Gaps = 5/51 (9%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFF 51 G+ G TT + L + V ++K + Sbjct: 9 TGVPGVGSTTSSQLA-----MDNLRKEGVNYKMVSFGSVMFEVAKEENLVS 54 >3a00_A Guanylate kinase, GMP kinase; domain movement, dimerization, acetylation, ATP-binding, nucleotide-binding, phosphoprotein, transferase; 1.80A {Saccharomyces cerevisiae} PDB: 1ex6_A* 1ex7_A 1gky_A* 2zzz_A 2zzy_A (A:) Length = 186 Score = 27.0 bits (58), Expect = 0.92 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 1 MGLSESGKTTLLEAIF 16 G S +GK+TLL+ +F Sbjct: 7 SGPSGTGKSTLLKKLF 22 >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A (A:1-182) Length = 182 Score = 27.0 bits (59), Expect = 0.98 Identities = 5/15 (33%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 GL GK+T + + Sbjct: 10 TGLPGVGKSTFSKNL 24 >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} (A:1-238) Length = 238 Score = 26.8 bits (57), Expect = 1.0 Identities = 5/16 (31%), Positives = 9/16 (56%) Query: 1 MGLSESGKTTLLEAIF 16 +G +SGK+T + Sbjct: 13 IGHVDSGKSTTTGHLI 28 >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} (A:58-294) Length = 237 Score = 26.7 bits (57), Expect = 1.1 Identities = 4/16 (25%), Positives = 9/16 (56%) Query: 1 MGLSESGKTTLLEAIF 16 G +GKT+ ++ + Sbjct: 14 AGQYSTGKTSFIQYLL 29 >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* (A:) Length = 263 Score = 26.5 bits (58), Expect = 1.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S SGK+T L + L Sbjct: 56 IGPSGSGKSTFLRCLNLL 73 >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} (A:) Length = 240 Score = 26.4 bits (58), Expect = 1.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 1 MGLSESGKTTLLEAIF 16 +G + +GKTT L AI Sbjct: 38 IGANGAGKTTTLSAIA 53 >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} (A:162-365) Length = 204 Score = 26.4 bits (57), Expect = 1.4 Identities = 10/80 (12%), Positives = 22/80 (27%), Gaps = 3/80 (3%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 +G SGK+ L+ + + + F+ + QY + + Sbjct: 15 LGGESSGKSVLVNKLA---AVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXALGHQR 71 Query: 61 FILSEKMDIPHVFLPMVHFP 80 +I + F Sbjct: 72 YIDYAVRHSHKIAFIDTDFI 91 >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome assembly, GTP-binding; HET: GNP; 1.90A {Aquifex aeolicus} (A:1-190,A:295-308) Length = 204 Score = 26.6 bits (57), Expect = 1.4 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+TLL + Sbjct: 16 VGKPNVGKSTLLNNL 30 >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} (A:) Length = 198 Score = 26.6 bits (57), Expect = 1.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 G S +GK+TLL+ + Sbjct: 10 SGPSGAGKSTLLKKL 24 >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 2.07A {Thermus thermophilus HB8} (A:158-334) Length = 177 Score = 26.3 bits (56), Expect = 1.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G +GK++LL A+ Sbjct: 6 VGYPNAGKSSLLAAM 20 >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA ATG; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* (A:183-574) Length = 392 Score = 26.4 bits (57), Expect = 1.4 Identities = 5/15 (33%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G + SGK+ + A+ Sbjct: 38 AGTTGSGKSVGVNAM 52 >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, periplasm, translation; 2.80A {Escherichia coli K12} PDB: 3deg_C* (D:1-185) Length = 185 Score = 26.3 bits (56), Expect = 1.6 Identities = 5/16 (31%), Positives = 9/16 (56%) Query: 1 MGLSESGKTTLLEAIF 16 + + GK+TL + I Sbjct: 10 IAHIDHGKSTLSDRII 25 >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} (A:) Length = 194 Score = 26.2 bits (56), Expect = 1.7 Identities = 7/62 (11%), Positives = 13/62 (20%), Gaps = 5/62 (8%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 G+ GK+T+L + L + D + Sbjct: 7 TGIPGVGKSTVLAKV-----KEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLS 61 Query: 61 FI 62 Sbjct: 62 VE 63 >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} (A:) Length = 243 Score = 26.0 bits (56), Expect = 2.0 Identities = 6/18 (33%), Positives = 9/18 (50%) Query: 1 MGLSESGKTTLLEAIFLF 18 G S GK+T+ + F Sbjct: 34 AGPSGGGKSTIFSLLERF 51 >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} (A:) Length = 262 Score = 25.8 bits (56), Expect = 2.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S SGK+T L I Sbjct: 38 IGSSGSGKSTFLRCINFL 55 >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A (A:69-307) Length = 239 Score = 26.0 bits (55), Expect = 2.1 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 +G + GK+T L A+ Sbjct: 7 LGDMKRGKSTFLNALI 22 >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} (A:1-249) Length = 249 Score = 25.9 bits (57), Expect = 2.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 1 MGLSESGKTTLLEAIFLF 18 GL+ +GKTTLL + + Sbjct: 53 YGLNGAGKTTLLNILNAY 70 >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii OT3} (A:1-119,A:215-316) Length = 221 Score = 25.6 bits (55), Expect = 2.2 Identities = 5/15 (33%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+T A Sbjct: 6 VGKPNVGKSTFFSAA 20 >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} (A:) Length = 170 Score = 25.7 bits (54), Expect = 2.2 Identities = 3/15 (20%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G + GK++++ Sbjct: 9 LGEAAVGKSSIVLRF 23 >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein LOLD; structural genomics, NPPSFA; 1.70A {Aquifex aeolicus VF5} PDB: 2pcl_A (A:) Length = 224 Score = 25.6 bits (56), Expect = 2.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S SGK+TLL + L Sbjct: 36 IGASGSGKSTLLYILGLL 53 >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} (1:1-234) Length = 234 Score = 25.9 bits (56), Expect = 2.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L I Sbjct: 35 LGPSGCGKTTTLRMI 49 >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell membrane, GTP-binding, ION transport; 2.50A {Legionella pneumophila} (A:1-169,A:253-256) Length = 173 Score = 25.8 bits (55), Expect = 2.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G GKTTL A+ Sbjct: 7 IGNPNCGKTTLFNAL 21 >1l2t_A Hypothetical ABC transporter ATP-binding protein MJ0796; ABC transporters, ATPase, walker-A, NBD, transport protein; HET: ATP; 1.90A {Methanocaldococcus jannaschii} (A:) Length = 235 Score = 25.7 bits (56), Expect = 2.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 1 MGLSESGKTTLLEAIFLF 18 MG S SGK+T+L I Sbjct: 37 MGPSGSGKSTMLNIIGCL 54 >3dhw_C Methionine import ATP-binding protein METN; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} (C:1-245) Length = 245 Score = 25.7 bits (56), Expect = 2.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S +GK+TL+ + Sbjct: 37 IGASGAGKSTLIRCV 51 >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} (A:) Length = 247 Score = 25.6 bits (55), Expect = 2.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 1 MGLSESGKTTLLEAIFLFGE 20 +G S SGK+TL + I F Sbjct: 41 VGRSGSGKSTLTKLIQRFYI 60 >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} (A:1-241) Length = 241 Score = 25.6 bits (56), Expect = 2.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTTLL + Sbjct: 36 IGASGCGKTTLLRCL 50 >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} (A:) Length = 183 Score = 25.6 bits (55), Expect = 2.4 Identities = 4/15 (26%), Positives = 5/15 (33%) Query: 1 MGLSESGKTTLLEAI 15 G GKT + Sbjct: 11 NGPFGVGKTHTAHTL 25 >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* (C:115-314) Length = 200 Score = 25.8 bits (55), Expect = 2.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGKTT + + Sbjct: 21 VGFNGSGKTTTIAKL 35 >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} (A:1-224) Length = 224 Score = 25.6 bits (56), Expect = 2.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GKT LE I Sbjct: 32 LGPTGAGKTLFLELI 46 >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} (A:69-265) Length = 197 Score = 25.5 bits (54), Expect = 2.5 Identities = 4/15 (26%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G + SGK++ + + Sbjct: 7 TGETGSGKSSFINTL 21 >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} (A:1-173) Length = 173 Score = 25.4 bits (54), Expect = 2.5 Identities = 5/15 (33%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+TL + Sbjct: 7 VGRPNVGKSTLFNKL 21 >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Bacillus halodurans c-125} (A:) Length = 189 Score = 25.4 bits (54), Expect = 2.5 Identities = 4/15 (26%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 G + GK+T + + Sbjct: 8 TGPAGVGKSTTCKRL 22 >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.20A {Agrobacterium tumefaciens str} (A:) Length = 191 Score = 25.4 bits (54), Expect = 2.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 G SGK+T+ EA+ Sbjct: 15 SGHPGSGKSTIAEAL 29 >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} (A:1-237) Length = 237 Score = 25.3 bits (55), Expect = 2.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGKTT+L I Sbjct: 47 LGPSGSGKTTILRLI 61 >2pze_A Cystic fibrosis transmembrane conductance regulator; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A (A:) Length = 229 Score = 25.5 bits (55), Expect = 2.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 G + +GKT+LL I Sbjct: 40 AGSTGAGKTSLLMMIM 55 >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} (A:) Length = 178 Score = 25.4 bits (55), Expect = 2.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G GKTTL++ I Sbjct: 6 TGEPGVGKTTLVKKI 20 >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} (A:) Length = 168 Score = 25.6 bits (54), Expect = 2.7 Identities = 4/15 (26%), Positives = 6/15 (40%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+ L Sbjct: 10 VGSGGVGKSALTLQF 24 >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, hydrolase; HET: GDP; 1.75A {Pyrococcus abyssi} (A:) Length = 262 Score = 25.5 bits (54), Expect = 2.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGKTTL Sbjct: 20 VGTAGSGKTTLTGEF 34 >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} (K:1-243) Length = 243 Score = 25.7 bits (56), Expect = 2.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S +GKTT + I Sbjct: 37 LGPSGAGKTTFMRII 51 >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} (A:1-239) Length = 239 Score = 25.4 bits (55), Expect = 2.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L I Sbjct: 43 LGPSGCGKTTTLRMI 57 >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} (A:392-573) Length = 182 Score = 25.3 bits (54), Expect = 2.8 Identities = 5/15 (33%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 G SGK + A+ Sbjct: 11 TGYMNSGKDAIARAL 25 >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} (A:) Length = 174 Score = 25.2 bits (54), Expect = 2.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 S +GKTTLL+ + Sbjct: 12 AAWSGTGKTTLLKKL 26 >2rhm_A Putative kinase; ZP_00765535.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Chloroflexus aurantiacus j-10-fl} (A:) Length = 193 Score = 25.3 bits (54), Expect = 2.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 G +GKTTL +A+ Sbjct: 11 TGHPATGKTTLSQAL 25 >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} (C:1-214) Length = 214 Score = 25.2 bits (55), Expect = 2.9 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + GK+TLL+ + Sbjct: 37 LGQNGCGKSTLLDLL 51 >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} (A:) Length = 203 Score = 25.4 bits (54), Expect = 3.0 Identities = 5/15 (33%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 +G +GK T E + Sbjct: 21 LGGPGAGKGTQCEKL 35 >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) class, TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima MSB8} (A:1-225) Length = 225 Score = 25.4 bits (55), Expect = 3.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L + Sbjct: 35 LGPSGCGKTTTLLML 49 >2yz2_A Putative ABC transporter ATP-binding protein TM_0222; cobalt transport, hydrolase, inner membrane, membrane, nucleotide- binding; 2.30A {Thermotoga maritima MSB8} (A:) Length = 266 Score = 25.3 bits (55), Expect = 3.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 G + SGK+TLL+ + Sbjct: 39 AGNTGSGKSTLLQIV 53 >1qzx_A SRP54, signal recognition 54 kDa protein; signal recognition particle, protein targeting, signaling protein; 4.00A {Sulfolobus solfataricus} (A:98-290) Length = 193 Score = 25.3 bits (54), Expect = 3.2 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G+ SGKTT + Sbjct: 13 VGVQGSGKTTTAGKL 27 >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori 26695} PDB: 1zui_A* (A:) Length = 168 Score = 25.3 bits (54), Expect = 3.2 Identities = 5/16 (31%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 +G SGK++L + + Sbjct: 13 IGFMGSGKSSLAQELG 28 >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} (A:1-231) Length = 231 Score = 25.3 bits (55), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+TLL I Sbjct: 35 LGPSGSGKSTLLYTI 49 >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A (W:96-285) Length = 190 Score = 25.3 bits (55), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +GL SGKTT + Sbjct: 12 VGLQGSGKTTTCSKL 26 >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} (A:1-230) Length = 230 Score = 25.3 bits (55), Expect = 3.4 Identities = 5/15 (33%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G + GK+TL + Sbjct: 40 LGGNGVGKSTLFQNF 54 >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} (A:5-221) Length = 217 Score = 25.1 bits (53), Expect = 3.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 1 MGLSESGKTTLLEAIF 16 +G + GKTTLL+ I Sbjct: 7 LGHVDHGKTTLLDHIR 22 >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A (A:1-168,A:240-278) Length = 207 Score = 25.3 bits (54), Expect = 3.5 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 + ++GKTT+ E + Sbjct: 19 ISHPDAGKTTITEKV 33 >2qy9_A Cell division protein FTSY; SRP receptor, protein targeting, simibi class GTPase, cell cycle, GTP-binding, inner membrane, membrane; 1.90A {Escherichia coli} (A:93-290) Length = 198 Score = 25.1 bits (53), Expect = 3.5 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G++ GKTT + + Sbjct: 13 VGVNGVGKTTTIGKL 27 >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A (C:) Length = 267 Score = 25.2 bits (54), Expect = 3.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 MG + SGK+TL + Sbjct: 52 MGPNGSGKSTLSATL 66 >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} (A:1-123,A:293-359) Length = 190 Score = 25.0 bits (55), Expect = 3.6 Identities = 8/20 (40%), Positives = 10/20 (50%), Gaps = 1/20 (5%) Query: 2 GLSESGKTTLLEAI-FLFGE 20 G + +GKT LLEA Sbjct: 33 GENGAGKTNLLEAAYLALTG 52 >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} (C:92-279) Length = 188 Score = 25.1 bits (54), Expect = 3.6 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G+ SGKTT + + Sbjct: 14 VGIQGSGKTTTAAKLARY 31 >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} (A:94-285) Length = 192 Score = 24.9 bits (54), Expect = 3.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G+ SGKTT + + Sbjct: 13 VGIQGSGKTTTVAKL 27 >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} (A:324-582) Length = 259 Score = 24.9 bits (53), Expect = 3.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S SGK+T+ F Sbjct: 52 VGRSGSGKSTIANLFTRF 69 >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} (A:1-228) Length = 228 Score = 24.9 bits (54), Expect = 3.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GK+ LE I Sbjct: 30 LGPTGAGKSVFLELI 44 >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus dsm 4304} PDB: 2oaq_1 (1:261-446) Length = 186 Score = 24.8 bits (53), Expect = 4.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Query: 6 SGKTTLLEAIFLF 18 SGKTT L AI F Sbjct: 11 SGKTTTLNAIXXF 23 >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} (A:1-197) Length = 197 Score = 25.0 bits (53), Expect = 4.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 +G + GKTTL AI Sbjct: 9 IGHVDHGKTTLTAAIT 24 >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} (B:) Length = 218 Score = 24.9 bits (53), Expect = 4.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G SGKT+LL + Sbjct: 18 AGPQNSGKTSLLTLL 32 >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} (A:) Length = 175 Score = 24.9 bits (53), Expect = 4.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 MG+S SGK+ + + Sbjct: 14 MGVSGSGKSAVASEV 28 >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} (A:174-359) Length = 186 Score = 24.6 bits (52), Expect = 4.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+TL AI Sbjct: 13 VGRPNVGKSTLFNAI 27 >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} (A:) Length = 173 Score = 24.6 bits (52), Expect = 4.3 Identities = 4/15 (26%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 +G G TT+ + Sbjct: 8 VGARGCGMTTVGREL 22 >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} (A:277-489) Length = 213 Score = 24.5 bits (53), Expect = 4.5 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + GKTT ++ + Sbjct: 42 VGPNGIGKTTFVKXL 56 >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum 3D7} (A:) Length = 228 Score = 24.7 bits (52), Expect = 4.6 Identities = 3/15 (20%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 G GK++ + + Sbjct: 35 SGAPNVGKSSFMNIV 49 >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} (B:) Length = 214 Score = 24.7 bits (52), Expect = 4.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +GL +SGKT L + Sbjct: 13 VGLCDSGKTLLFVRL 27 >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} (A:) Length = 260 Score = 24.5 bits (52), Expect = 5.1 Identities = 6/18 (33%), Positives = 13/18 (72%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G + SGK+T+ + ++ F Sbjct: 52 VGHTGSGKSTIAKLLYRF 69 >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A (A:97-299) Length = 203 Score = 24.6 bits (52), Expect = 5.1 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 1 MGLSESGKTTLLEAIF 16 +G++ +GKTT L + Sbjct: 15 VGVNGTGKTTSLAKMA 30 >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* (A:172-364) Length = 193 Score = 24.6 bits (52), Expect = 5.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGKT+L ++ Sbjct: 14 VGYTNSGKTSLFNSL 28 >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} (A:347-572) Length = 226 Score = 24.6 bits (53), Expect = 5.3 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + GKTT ++ + Sbjct: 42 VGPNGIGKTTFVKML 56 >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} (A:) Length = 263 Score = 24.6 bits (53), Expect = 5.5 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGKTTLL AI Sbjct: 36 LGPNGSGKTTLLRAI 50 >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} (A:) Length = 171 Score = 24.3 bits (51), Expect = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +GL +GKTT+L + Sbjct: 13 LGLDGAGKTTILYRL 27 >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} (A:1-47,A:135-236) Length = 149 Score = 24.3 bits (53), Expect = 5.8 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 G + SGK+T+ + I Sbjct: 22 DGPASSGKSTVAKII 36 >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} (A:) Length = 199 Score = 24.2 bits (51), Expect = 5.9 Identities = 6/15 (40%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 +G SGK T E + Sbjct: 18 IGGPGSGKGTQCEKL 32 >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure 2 function project, S2F, unknown function; 2.00A {Escherichia coli} (A:1-204) Length = 204 Score = 24.5 bits (52), Expect = 6.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G +GKTTLL I Sbjct: 10 TGFLGAGKTTLLRHI 24 >1z6g_A Guanylate kinase; structural genomics, SGC, structural genomics consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum 3D7} (A:1-55,A:105-218) Length = 169 Score = 24.4 bits (53), Expect = 6.3 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G S GK TL++ + Sbjct: 29 CGPSGVGKGTLIKKL 43 >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} (A:1-135,A:241-322) Length = 217 Score = 24.3 bits (53), Expect = 6.4 Identities = 8/16 (50%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Query: 6 SGKTTLLEAI-FLFGE 20 SGK+ +++AI ++FGE Sbjct: 35 SGKSNIIDAIKWVFGE 50 >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* (C:) Length = 249 Score = 24.2 bits (52), Expect = 6.5 Identities = 6/12 (50%), Positives = 10/12 (83%) Query: 1 MGLSESGKTTLL 12 +G + +GK+TLL Sbjct: 32 VGPNGAGKSTLL 43 >2p67_A LAO/AO transport system kinase; ARGK, structural genomics, PSI-2, protein structure initiative; 1.80A {Escherichia coli K12} (A:1-265) Length = 265 Score = 23.9 bits (50), Expect = 7.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G +GK+T LEA Sbjct: 62 TGTPGAGKSTFLEAF 76 >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} (A:159-342) Length = 184 Score = 23.9 bits (50), Expect = 7.5 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G GK+TLL + Sbjct: 6 VGFPSVGKSTLLSVV 20 >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} (A:1-114) Length = 114 Score = 23.8 bits (51), Expect = 7.6 Identities = 5/15 (33%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 +G SGK+T Sbjct: 8 IGCPGSGKSTWAREF 22 >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} (A:) Length = 237 Score = 23.8 bits (50), Expect = 7.8 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G GK++LL A+ Sbjct: 37 VGQVGCGKSSLLSALLAE 54 >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} (A:1-38,A:88-207) Length = 158 Score = 23.6 bits (51), Expect = 8.8 Identities = 6/15 (40%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 G S GK T+ + I Sbjct: 12 SGPSGVGKGTVRKRI 26 >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase; 2.10A {Mycobacterium tuberculosis} (A:1-50,A:103-207) Length = 155 Score = 23.8 bits (52), Expect = 9.4 Identities = 5/15 (33%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G S GK+T++ + Sbjct: 26 SGPSAVGKSTVVRCL 40 >1sgw_A Putative ABC transporter; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Pyrococcus furiosus dsm 3638} (A:1-88,A:151-214) Length = 152 Score = 23.8 bits (52), Expect = 9.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 1 MGLSESGKTTLLEAIFLF 18 G + GKTTLL+ I + Sbjct: 41 HGPNGIGKTTLLKTISTY 58 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.324 0.142 0.407 Gapped Lambda K H 0.267 0.0404 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 575,641 Number of extensions: 20889 Number of successful extensions: 311 Number of sequences better than 10.0: 1 Number of HSP's gapped: 311 Number of HSP's successfully gapped: 107 Length of query: 80 Length of database: 4,956,049 Length adjustment: 44 Effective length of query: 36 Effective length of database: 3,468,629 Effective search space: 124870644 Effective search space used: 124870644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)