RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781089|ref|YP_003065502.1| hypothetical protein
CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62]
         (80 letters)



>g1ii8.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus
          [TaxId: 2261]}
          Length = 369

 Score = 29.4 bits (64), Expect = 0.079
 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 2/22 (9%)

Query: 2  GLSESGKTTLLEAIF--LFGEA 21
          G + SGK++LL+AI   L+   
Sbjct: 30 GQNGSGKSSLLDAILVGLYWPL 51


>g1f2t.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus
          [TaxId: 2261]}
          Length = 292

 Score = 28.6 bits (62), Expect = 0.14
 Identities = 8/14 (57%), Positives = 12/14 (85%)

Query: 2  GLSESGKTTLLEAI 15
          G + SGK++LL+AI
Sbjct: 30 GQNGSGKSSLLDAI 43


>d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid
          dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId:
          9606]}
          Length = 203

 Score = 27.0 bits (59), Expect = 0.47
 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 4  SESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDG 42
           ++ K  L +++     AL  +L+ DP +V    DV  G
Sbjct: 15 GQTQKMNLFQSVT---SALDNSLAKDPTAVIFGEDVAFG 50


>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide
          biosynthesis protein MobB {Escherichia coli [TaxId:
          562]}
          Length = 170

 Score = 26.5 bits (57), Expect = 0.57
 Identities = 7/14 (50%), Positives = 10/14 (71%)

Query: 2  GLSESGKTTLLEAI 15
            S +GKTTLL+ +
Sbjct: 9  AWSGTGKTTLLKKL 22


>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia
          coli [TaxId: 562]}
          Length = 222

 Score = 26.5 bits (57), Expect = 0.59
 Identities = 10/58 (17%), Positives = 17/58 (29%), Gaps = 1/58 (1%)

Query: 2  GLSESGKTTLLEAI-FLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVD 58
          G + +GK+T + A        L L    +       S   D     +         +D
Sbjct: 31 GGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLD 88


>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015
          {Agrobacterium tumefaciens [TaxId: 358]}
          Length = 176

 Score = 26.5 bits (57), Expect = 0.59
 Identities = 12/40 (30%), Positives = 14/40 (35%), Gaps = 9/40 (22%)

Query: 1  MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVF 40
           G   SGK+T+         A ALA       V   SD  
Sbjct: 10 SGHPGSGKSTI---------AEALANLPGVPKVHFHSDDL 40


>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter,
          ATP-binding protein {Methanosarcina acetivorans [TaxId:
          2214]}
          Length = 229

 Score = 26.6 bits (58), Expect = 0.61
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + +GKT  LE I
Sbjct: 32 LGPTGAGKTLFLELI 46


>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV,
          N-terminal domain {Archaeon Sulfolobus solfataricus
          [TaxId: 2287]}
          Length = 242

 Score = 26.6 bits (58), Expect = 0.68
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G S +GKTT +  I
Sbjct: 37 LGPSGAGKTTFMRII 51


>d1tg7a3 b.18.1.27 (A:849-1011) Beta-galactosidase LacA, domains 4
          and 5 {Penicillium sp. [TaxId: 5081]}
          Length = 163

 Score = 26.3 bits (58), Expect = 0.74
 Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 4/54 (7%)

Query: 17 LFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQFILSEKMDIP 70
          L+ E         P   +  S  F G++K    F++    +D    L    DIP
Sbjct: 13 LYAERQGFHQPQPPTQKWDSSSPFTGLTKPGIRFYSTSFDLD----LPSGYDIP 62


>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide
          biosynthesis protein MobB {Bacillus stearothermophilus
          [TaxId: 1422]}
          Length = 165

 Score = 26.3 bits (57), Expect = 0.75
 Identities = 8/14 (57%), Positives = 9/14 (64%)

Query: 2  GLSESGKTTLLEAI 15
          G   SGKTTL+E  
Sbjct: 8  GYKHSGKTTLMEKW 21


>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK,
          N-terminal domain {Escherichia coli [TaxId: 562]}
          Length = 232

 Score = 26.1 bits (57), Expect = 0.90
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G S  GK+TLL  I
Sbjct: 32 VGPSGCGKSTLLRMI 46


>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii
          [TaxId: 2190]}
          Length = 254

 Score = 26.1 bits (57), Expect = 0.90
 Identities = 7/16 (43%), Positives = 11/16 (68%)

Query: 1  MGLSESGKTTLLEAIF 16
          +G + SGK+TL+  I 
Sbjct: 36 IGPNGSGKSTLINVIT 51


>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor
          beta-subunit {Baker's yeast (Saccharomyces cerevisiae)
          [TaxId: 4932]}
          Length = 209

 Score = 26.1 bits (56), Expect = 0.93
 Identities = 7/15 (46%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
           G   SGKT+LL  +
Sbjct: 9  AGPQNSGKTSLLTLL 23


>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase
          {Streptomyces venezuelae [TaxId: 54571]}
          Length = 178

 Score = 25.8 bits (55), Expect = 0.96
 Identities = 4/15 (26%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
           G S +GK+ ++  +
Sbjct: 9  NGGSSAGKSGIVRCL 23


>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK,
          N-terminal domain {Archaeon Thermococcus litoralis
          [TaxId: 2265]}
          Length = 240

 Score = 25.7 bits (56), Expect = 1.0
 Identities = 8/15 (53%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G S  GKTT L  I
Sbjct: 35 LGPSGCGKTTTLRMI 49


>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId:
          562]}
          Length = 171

 Score = 25.8 bits (55), Expect = 1.1
 Identities = 6/15 (40%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          MG+S SGK+ +   +
Sbjct: 12 MGVSGSGKSAVASEV 26


>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter
          {Thermotoga maritima, TM1139 [TaxId: 2336]}
          Length = 240

 Score = 25.6 bits (56), Expect = 1.1
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + +GKTT L AI
Sbjct: 38 IGANGAGKTTTLSAI 52


>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC
          transporter MsbA, C-terminal domain {Salmonella
          typhimurium [TaxId: 90371]}
          Length = 253

 Score = 25.6 bits (56), Expect = 1.1
 Identities = 8/18 (44%), Positives = 11/18 (61%)

Query: 1  MGLSESGKTTLLEAIFLF 18
          +G S SGK+T+   I  F
Sbjct: 47 VGRSGSGKSTIASLITRF 64


>g1xew.1 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furiosus
          [TaxId: 2261]}
          Length = 329

 Score = 25.7 bits (55), Expect = 1.1
 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query: 2  GLSESGKTTLLEAI-FLFGE 20
          G + SGK+ + +AI F+ G 
Sbjct: 33 GANGSGKSNIGDAILFVLGG 52


>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import
          ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus
          [TaxId: 2234]}
          Length = 240

 Score = 25.7 bits (56), Expect = 1.2
 Identities = 6/15 (40%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + +GK+  LE I
Sbjct: 30 LGPTGAGKSVFLELI 44


>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010
          {Thermotoga maritima [TaxId: 2336]}
          Length = 134

 Score = 25.7 bits (56), Expect = 1.2
 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 37 SDVFDGISKNQYGFFTGKIKVDAQFILSEKMDIPHVFLPMVHFP 80
           D+F+  SK    FFTG + V    +++++  + +  +  V F 
Sbjct: 2  DDIFERGSKGSSDFFTGNVWVKM--LVTDENGVFNTQVYDVVFE 43


>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine
          permease {Salmonella typhimurium [TaxId: 90371]}
          Length = 258

 Score = 25.6 bits (56), Expect = 1.2
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G S SGK+T L  I
Sbjct: 34 IGSSGSGKSTFLRCI 48


>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo
          sapiens), ARL8A [TaxId: 9606]}
          Length = 164

 Score = 25.4 bits (54), Expect = 1.2
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  SGKTT +  I
Sbjct: 8  VGLQYSGKTTFVNVI 22


>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain
          {Bacteriophage T4 [TaxId: 10665]}
          Length = 152

 Score = 25.5 bits (54), Expect = 1.2
 Identities = 5/16 (31%), Positives = 7/16 (43%)

Query: 1  MGLSESGKTTLLEAIF 16
          +G   SGK+T      
Sbjct: 8  IGCPGSGKSTWAREFI 23


>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima
          [TaxId: 2336]}
          Length = 308

 Score = 25.4 bits (54), Expect = 1.3
 Identities = 9/20 (45%), Positives = 16/20 (80%), Gaps = 1/20 (5%)

Query: 2  GLSESGKTTLLEAI-FLFGE 20
          G + SGK+ +++AI ++FGE
Sbjct: 31 GPNGSGKSNIIDAIKWVFGE 50


>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast
          (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 427

 Score = 25.4 bits (54), Expect = 1.4
 Identities = 7/16 (43%), Positives = 12/16 (75%), Gaps = 1/16 (6%)

Query: 6  SGKTTLLEAI-FLFGE 20
          SGK+ +++AI F+ G 
Sbjct: 36 SGKSNMMDAISFVLGV 51


>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal
          (G) domain {Thermus thermophilus [TaxId: 274]}
          Length = 276

 Score = 25.4 bits (55), Expect = 1.4
 Identities = 6/22 (27%), Positives = 10/22 (45%)

Query: 1  MGLSESGKTTLLEAIFLFGEAL 22
              ++GKTT  E I  +   +
Sbjct: 12 AAHIDAGKTTTTERILYYTGRI 33


>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical  kinase-like protein
          Aq_1292 {Aquifex aeolicus [TaxId: 63363]}
          Length = 178

 Score = 25.3 bits (54), Expect = 1.4
 Identities = 7/15 (46%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
           G    GKTTL++ I
Sbjct: 6  TGEPGVGKTTLVKKI 20


>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain
          {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
          Length = 183

 Score = 25.4 bits (54), Expect = 1.4
 Identities = 7/25 (28%), Positives = 9/25 (36%), Gaps = 7/25 (28%)

Query: 2  GLSESGKTTLLEAIFLFGEALALAL 26
          G   SGK  +         AL + L
Sbjct: 13 GYMNSGKDAI-------ARALQVTL 30


>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor
          beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 207

 Score = 25.4 bits (54), Expect = 1.5
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL +SGKT L   +
Sbjct: 6  VGLCDSGKTLLFVRL 20


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export
          ATP-binding/permease protein SAV1866 {Staphylococcus
          aureus [TaxId: 1280]}
          Length = 255

 Score = 25.1 bits (55), Expect = 1.8
 Identities = 8/18 (44%), Positives = 12/18 (66%)

Query: 1  MGLSESGKTTLLEAIFLF 18
          +G+S  GK+TL+  I  F
Sbjct: 50 VGMSGGGKSTLINLIPRF 67


>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase
          (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
          Length = 195

 Score = 25.0 bits (53), Expect = 1.8
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
           GLS +GKTT+  A+
Sbjct: 25 TGLSGAGKTTVSMAL 39


>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022,
          N-terminal domain {Pyrococcus horikoshii [TaxId:
          53953]}
          Length = 239

 Score = 25.1 bits (55), Expect = 1.8
 Identities = 8/15 (53%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G S  GKTT L  I
Sbjct: 38 LGPSGCGKTTTLRMI 52


>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA,
          C-terminal domain {Lactococcus lactis [TaxId: 1358]}
          Length = 242

 Score = 24.8 bits (54), Expect = 1.8
 Identities = 6/18 (33%), Positives = 9/18 (50%)

Query: 1  MGLSESGKTTLLEAIFLF 18
           G S  GK+T+   +  F
Sbjct: 34 AGPSGGGKSTIFSLLERF 51


>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12
          uptake, BtuD {Escherichia coli [TaxId: 562]}
          Length = 231

 Score = 24.9 bits (54), Expect = 1.8
 Identities = 6/15 (40%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + +GK+TLL  +
Sbjct: 31 VGPNGAGKSTLLARM 45


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544
          {Thermotoga maritima [TaxId: 2336]}
          Length = 238

 Score = 25.0 bits (54), Expect = 1.9
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + +GKTT L  I
Sbjct: 34 IGPNGAGKTTTLRII 48


>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance
          regulator, CFTR, nucleotide-binding domain {Mouse (Mus
          musculus) [TaxId: 10090]}
          Length = 281

 Score = 24.9 bits (54), Expect = 2.0
 Identities = 8/18 (44%), Positives = 10/18 (55%)

Query: 1  MGLSESGKTTLLEAIFLF 18
           G + SGKT+LL  I   
Sbjct: 68 TGSTGSGKTSLLMLILGE 85


>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS
          kinase) {Fungus (Penicillium chrysogenum) [TaxId:
          5076]}
          Length = 208

 Score = 24.8 bits (53), Expect = 2.1
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 2  GLSESGKTTLLEAIF 16
          GLS SGK+TL   + 
Sbjct: 31 GLSASGKSTLAVELE 45


>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces
          cerevisiae) [TaxId: 4932]}
          Length = 166

 Score = 24.7 bits (52), Expect = 2.1
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTTLL  +
Sbjct: 6  LGLDNAGKTTLLHML 20


>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus
          halodurans [TaxId: 86665]}
          Length = 176

 Score = 24.6 bits (52), Expect = 2.3
 Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 10/51 (19%)

Query: 1  MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFF 51
           G +  GK+T         + LA  L N   S +++ D+ + +    Y   
Sbjct: 8  TGPAGVGKSTT-------CKRLAAQLDN---SAYIEGDIINHMVVGGYRPP 48


>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus
          musculus), ARL2 [TaxId: 10090]}
          Length = 165

 Score = 24.6 bits (52), Expect = 2.3
 Identities = 7/15 (46%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTT+L+  
Sbjct: 8  LGLDNAGKTTILKKF 22


>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein
          {Escherichia coli [TaxId: 562]}
          Length = 241

 Score = 24.5 bits (53), Expect = 2.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 1  MGLSESGKTTLLEAIFLF 18
          +G S SGK+TL + I  F
Sbjct: 35 VGRSGSGKSTLTKLIQRF 52


>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal
          (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
          Length = 267

 Score = 24.5 bits (52), Expect = 2.4
 Identities = 9/15 (60%), Positives = 12/15 (80%)

Query: 1  MGLSESGKTTLLEAI 15
          +G + SGKTTL EA+
Sbjct: 8  VGHAGSGKTTLTEAL 22


>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955
          {Pyrococcus abyssi [TaxId: 29292]}
          Length = 244

 Score = 24.6 bits (52), Expect = 2.4
 Identities = 10/41 (24%), Positives = 16/41 (39%), Gaps = 2/41 (4%)

Query: 1  MGLSESGKTTLLEAI--FLFGEALALALSNDPVSVFLKSDV 39
          +G + SGKTTL      +L        ++ D     L  + 
Sbjct: 6  VGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEP 46


>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit)
          {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 195

 Score = 24.5 bits (52), Expect = 2.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)

Query: 1  MGLSESGKTTLL 12
          +G  ESGK+T++
Sbjct: 8  LGAGESGKSTIV 19


>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo
          sapiens), ARL1 [TaxId: 9606]}
          Length = 169

 Score = 24.3 bits (51), Expect = 2.8
 Identities = 7/15 (46%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTT+L  +
Sbjct: 11 LGLDGAGKTTILYRL 25


>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2),
          N-terminal (G) domain {Baker's yeast (Saccharomyces
          cerevisiae) [TaxId: 4932]}
          Length = 341

 Score = 24.3 bits (52), Expect = 2.9
 Identities = 4/15 (26%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +   + GK+TL +++
Sbjct: 23 IAHVDHGKSTLTDSL 37


>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis
          [TaxId: 1423]}
          Length = 195

 Score = 24.3 bits (51), Expect = 3.1
 Identities = 4/16 (25%), Positives = 9/16 (56%)

Query: 1  MGLSESGKTTLLEAIF 16
           G S  GK++ + ++ 
Sbjct: 29 AGRSNVGKSSFINSLI 44


>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit)
          {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 200

 Score = 24.1 bits (51), Expect = 3.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)

Query: 2  GLSESGKTTLL 12
          G  ESGK+T +
Sbjct: 9  GTGESGKSTFI 19


>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895
          {Pyrococcus furiosus [TaxId: 2261]}
          Length = 200

 Score = 24.1 bits (52), Expect = 3.1
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
           G +  GKTTLL+ I
Sbjct: 33 HGPNGIGKTTLLKTI 47


>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus)
          [TaxId: 10029]}
          Length = 186

 Score = 24.3 bits (51), Expect = 3.2
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTTLL  +
Sbjct: 19 LGLDNAGKTTLLHML 33


>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3'
          phosphatase, C-terminal domain {Mouse (Mus musculus)
          [TaxId: 10090]}
          Length = 172

 Score = 24.1 bits (51), Expect = 3.2
 Identities = 4/16 (25%), Positives = 9/16 (56%)

Query: 1  MGLSESGKTTLLEAIF 16
          +G   +GK+T ++   
Sbjct: 20 VGFPGAGKSTFIQEHL 35


>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP)
          carboxykinase (ATP-oxaloacetate carboxy-lyase)
          {Escherichia coli [TaxId: 562]}
          Length = 313

 Score = 24.2 bits (52), Expect = 3.2
 Identities = 8/11 (72%), Positives = 9/11 (81%)

Query: 1  MGLSESGKTTL 11
           GLS +GKTTL
Sbjct: 20 FGLSGTGKTTL 30


>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and
          middle domains {Thermotoga maritima [TaxId: 2336]}
          Length = 171

 Score = 24.3 bits (51), Expect = 3.2
 Identities = 5/15 (33%), Positives = 8/15 (53%)

Query: 1  MGLSESGKTTLLEAI 15
          +G    GK+TL   +
Sbjct: 6  VGRPNVGKSTLFNKL 20


>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid
          dehydrogenase, Pyr module {Thermus thermophilus [TaxId:
          274]}
          Length = 186

 Score = 24.0 bits (51), Expect = 3.3
 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 3/33 (9%)

Query: 10 TLLEAIFLFGEALALALSNDPVSVFLKSDVFDG 42
          T+++A+     AL   ++ DP  V L  DV   
Sbjct: 4  TMVQAL---NRALDEEMAKDPRVVVLGEDVGKR 33


>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and
          middle domains {Thermotoga maritima [TaxId: 2336]}
          Length = 186

 Score = 24.3 bits (51), Expect = 3.4
 Identities = 7/15 (46%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G    GK+TL  AI
Sbjct: 14 VGRPNVGKSTLFNAI 28


>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus
          thermophilus [TaxId: 274]}
          Length = 178

 Score = 23.9 bits (50), Expect = 3.4
 Identities = 6/15 (40%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G    GK+TLL  +
Sbjct: 11 VGKPNVGKSTLLNNL 25


>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit)
          {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 200

 Score = 24.1 bits (51), Expect = 3.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)

Query: 2  GLSESGKTTLLE 13
          G  ESGK+T L+
Sbjct: 9  GAGESGKSTFLK 20


>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit,
          N-terminal (G) domain {Archaeon Pyrococcus abyssi
          [TaxId: 29292]}
          Length = 195

 Score = 23.8 bits (50), Expect = 3.8
 Identities = 7/15 (46%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +G  + GKTTL +A+
Sbjct: 11 VGHVDHGKTTLTKAL 25


>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP)
          carboxykinase (ATP-oxaloacetate carboxy-lyase)
          {Trypanosoma cruzi [TaxId: 5693]}
          Length = 323

 Score = 23.8 bits (51), Expect = 3.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)

Query: 1  MGLSESGKTTL 11
           GLS +GKTTL
Sbjct: 20 FGLSGTGKTTL 30


>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC
          domain {Human (Homo sapiens) [TaxId: 9606]}
          Length = 251

 Score = 23.7 bits (51), Expect = 3.9
 Identities = 5/18 (27%), Positives = 10/18 (55%)

Query: 1  MGLSESGKTTLLEAIFLF 18
          +G + SGK+T+   +   
Sbjct: 46 VGPNGSGKSTVAALLQNL 63


>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP)
          carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus
          thermophilus [TaxId: 274]}
          Length = 318

 Score = 23.8 bits (51), Expect = 4.0
 Identities = 8/11 (72%), Positives = 9/11 (81%)

Query: 1  MGLSESGKTTL 11
           GLS +GKTTL
Sbjct: 20 FGLSGTGKTTL 30


>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit)
          {Cow (Bos taurus) [TaxId: 9913]}
          Length = 221

 Score = 23.9 bits (51), Expect = 4.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)

Query: 2  GLSESGKTTLL 12
          G  ESGK+T++
Sbjct: 13 GAGESGKSTIV 23


>d1bifa1 c.37.1.7 (A:37-249)
          6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase,
          kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 213

 Score = 23.8 bits (50), Expect = 4.2
 Identities = 10/49 (20%), Positives = 14/49 (28%), Gaps = 5/49 (10%)

Query: 2  GLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGF 50
          GL   GKT + + +        L     P   F        + K    F
Sbjct: 9  GLPARGKTYISKKL-----TRYLNFIGVPTREFNVGQYRRDMVKTYKSF 52


>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B),
          Pyr module {Pseudomonas putida [TaxId: 303]}
          Length = 204

 Score = 23.9 bits (51), Expect = 4.3
 Identities = 11/45 (24%), Positives = 19/45 (42%), Gaps = 5/45 (11%)

Query: 10 TLLEAIFLFGEALALALSNDPVSVFLKSDVFD--GISKNQYGFFT 52
          T+++A+     A+ + L  D   V    DV    G+ +   G  T
Sbjct: 6  TMIQAL---RSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQT 47


>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus
          horikoshii [TaxId: 53953]}
          Length = 184

 Score = 23.9 bits (50), Expect = 4.4
 Identities = 6/16 (37%), Positives = 9/16 (56%)

Query: 1  MGLSESGKTTLLEAIF 16
           G S  GK+TL+  + 
Sbjct: 6  AGRSNVGKSTLIYRLT 21


>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo
          sapiens), ARF1 [TaxId: 9606]}
          Length = 160

 Score = 23.8 bits (50), Expect = 4.5
 Identities = 7/15 (46%), Positives = 11/15 (73%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTT+L  +
Sbjct: 6  VGLDAAGKTTILYKL 20


>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB
          {Methylobacterium extorquens [TaxId: 408]}
          Length = 323

 Score = 23.7 bits (50), Expect = 4.5
 Identities = 4/11 (36%), Positives = 8/11 (72%)

Query: 6  SGKTTLLEAIF 16
           GK+T ++A+ 
Sbjct: 62 VGKSTTIDALG 72


>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain
          {Escherichia coli [TaxId: 562]}
          Length = 179

 Score = 23.5 bits (49), Expect = 4.6
 Identities = 6/15 (40%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G    GK+TLL  +
Sbjct: 11 VGRPNVGKSTLLNKL 25


>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus
          musculus), ARL3 [TaxId: 10090]}
          Length = 176

 Score = 23.8 bits (50), Expect = 4.6
 Identities = 8/15 (53%), Positives = 12/15 (80%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTTLL+ +
Sbjct: 22 LGLDNAGKTTLLKQL 36


>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate
          dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId:
          9606]}
          Length = 192

 Score = 23.5 bits (50), Expect = 4.8
 Identities = 8/34 (23%), Positives = 14/34 (41%), Gaps = 3/34 (8%)

Query: 6  SGKTTLLEAIFLFGEALALALSNDPVSVFLKSDV 39
          S + T+ +AI    + +   L  D     L  +V
Sbjct: 1  SLQVTVRDAI---NQGMDEELERDEKVFLLGEEV 31


>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal
          domain {Methanococcus maripaludis [TaxId: 39152]}
          Length = 179

 Score = 23.5 bits (49), Expect = 5.1
 Identities = 6/15 (40%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
           G  + GKTTL + +
Sbjct: 11 FGHIDHGKTTLSKVL 25


>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b,
          N-terminal (G) domain {Archaeon Methanobacterium
          thermoautotrophicum [TaxId: 145262]}
          Length = 227

 Score = 23.5 bits (49), Expect = 5.3
 Identities = 7/10 (70%), Positives = 8/10 (80%)

Query: 6  SGKTTLLEAI 15
           GKTTLL+ I
Sbjct: 16 HGKTTLLDHI 25


>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli
          [TaxId: 562]}
          Length = 188

 Score = 23.2 bits (48), Expect = 5.6
 Identities = 5/15 (33%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
           G S +GK++ L  +
Sbjct: 22 AGRSNAGKSSALNTL 36


>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit,
          N-terminal (G) domain {Sulfolobus solfataricus [TaxId:
          2287]}
          Length = 205

 Score = 23.4 bits (49), Expect = 5.8
 Identities = 7/10 (70%), Positives = 9/10 (90%)

Query: 6  SGKTTLLEAI 15
           GKTTL++AI
Sbjct: 19 HGKTTLVQAI 28


>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle
          domain {Thermus thermophilus [TaxId: 274]}
          Length = 180

 Score = 23.5 bits (49), Expect = 5.9
 Identities = 6/14 (42%), Positives = 10/14 (71%)

Query: 2  GLSESGKTTLLEAI 15
          G   +GK++LL A+
Sbjct: 8  GYPNAGKSSLLAAM 21


>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle
          domain {Bacillus subtilis [TaxId: 1423]}
          Length = 185

 Score = 23.0 bits (48), Expect = 6.5
 Identities = 6/14 (42%), Positives = 8/14 (57%)

Query: 2  GLSESGKTTLLEAI 15
          G    GK+TLL  +
Sbjct: 8  GFPSVGKSTLLSVV 21


>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release
          factor ERF2, G domain {Fission yeast
          (Schizosaccharomyces pombe) [TaxId: 4896]}
          Length = 245

 Score = 23.3 bits (49), Expect = 6.6
 Identities = 5/17 (29%), Positives = 8/17 (47%)

Query: 6  SGKTTLLEAIFLFGEAL 22
          +GK+TL   I      +
Sbjct: 35 AGKSTLGGNILFLTGMV 51


>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus
          norvegicus) [TaxId: 10116]}
          Length = 299

 Score = 22.9 bits (48), Expect = 6.9
 Identities = 5/15 (33%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G   +GK+++LE  
Sbjct: 32 VGGQSAGKSSVLENF 46


>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal
          domain {Escherichia coli [TaxId: 562]}
          Length = 222

 Score = 22.9 bits (48), Expect = 7.1
 Identities = 8/14 (57%), Positives = 9/14 (64%)

Query: 2  GLSESGKTTLLEAI 15
          G   +GKTTLL  I
Sbjct: 10 GFLGAGKTTLLRHI 23


>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit
          cysN/C, EF-Tu domain G-like domain {Pseudomonas
          syringae pv. tomato [TaxId: 323]}
          Length = 222

 Score = 22.9 bits (48), Expect = 7.1
 Identities = 4/17 (23%), Positives = 9/17 (52%)

Query: 6  SGKTTLLEAIFLFGEAL 22
           GK+TL+  +    + +
Sbjct: 20 DGKSTLIGRLLHDSKMI 36


>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu),
          N-terminal (G) domain {Cow (Bos taurus), mitochondrial
          [TaxId: 9913]}
          Length = 196

 Score = 23.1 bits (49), Expect = 7.1
 Identities = 7/10 (70%), Positives = 7/10 (70%)

Query: 6  SGKTTLLEAI 15
           GKTTL  AI
Sbjct: 14 HGKTTLTAAI 23


>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha,
          N-terminal (G) domain {Archaeon Sulfolobus solfataricus
          [TaxId: 2287]}
          Length = 224

 Score = 22.9 bits (48), Expect = 7.8
 Identities = 4/17 (23%), Positives = 9/17 (52%)

Query: 6  SGKTTLLEAIFLFGEAL 22
           GK+TL+  + +    +
Sbjct: 14 HGKSTLVGRLLMDRGFI 30


>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu),
          N-terminal (G) domain {Thermus thermophilus [TaxId:
          274]}
          Length = 204

 Score = 23.0 bits (49), Expect = 8.1
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +G  + GKTTL  A+
Sbjct: 9  IGHVDHGKTTLTAAL 23


>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal
          domain {Fission yeast (Schizosaccharomyces pombe)
          [TaxId: 4896]}
          Length = 296

 Score = 22.9 bits (48), Expect = 8.2
 Identities = 6/14 (42%), Positives = 8/14 (57%)

Query: 2  GLSESGKTTLLEAI 15
          G+   GK+T   AI
Sbjct: 17 GMPNVGKSTFFRAI 30


>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga
          maritima [TaxId: 2336]}
          Length = 160

 Score = 22.6 bits (47), Expect = 8.5
 Identities = 6/15 (40%), Positives = 9/15 (60%)

Query: 1  MGLSESGKTTLLEAI 15
          +G    GK+TLL  +
Sbjct: 6  VGKPNVGKSTLLNRL 20


>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum
          [TaxId: 44689]}
          Length = 306

 Score = 22.9 bits (48), Expect = 8.7
 Identities = 6/10 (60%), Positives = 9/10 (90%)

Query: 6  SGKTTLLEAI 15
          SGK+++LE I
Sbjct: 35 SGKSSVLENI 44


>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo
          sapiens), ARL5A [TaxId: 9606]}
          Length = 177

 Score = 22.7 bits (47), Expect = 9.0
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 1  MGLSESGKTTLLEAI 15
          +GL  +GKTT+L   
Sbjct: 21 VGLDNAGKTTILYQF 35


>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein
          MetN {Escherichia coli [TaxId: 562]}
          Length = 240

 Score = 22.5 bits (48), Expect = 9.7
 Identities = 7/21 (33%), Positives = 12/21 (57%)

Query: 1  MGLSESGKTTLLEAIFLFGEA 21
          +G S +GK+TL+  + L    
Sbjct: 37 IGASGAGKSTLIRCVNLLERP 57


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.324    0.142    0.407 

Gapped
Lambda     K      H
   0.267   0.0435    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 287,008
Number of extensions: 11063
Number of successful extensions: 188
Number of sequences better than 10.0: 1
Number of HSP's gapped: 188
Number of HSP's successfully gapped: 100
Length of query: 80
Length of database: 2,407,596
Length adjustment: 46
Effective length of query: 34
Effective length of database: 1,776,016
Effective search space: 60384544
Effective search space used: 60384544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.6 bits)