RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >gnl|CDD|178387 PLN02790, PLN02790, transketolase. Length = 654 Score = 28.4 bits (64), Expect = 0.40 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 29 KDKYQKIVKIGDHAES--IKTLADFIKDYPDCDLELENLVTDDI 70 K + K K G E+ A++ K YP+ EL++L++ ++ Sbjct: 283 KSHWSKHTKEGAALEAEWNAKFAEYKKKYPEEAAELKSLISGEL 326 >gnl|CDD|182990 PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional. Length = 297 Score = 27.9 bits (63), Expect = 0.63 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 6/29 (20%) Query: 48 LADFIKDYPDCDLEL------ENLVTDDI 70 L+ F + +PD D+ L E+ + DD+ Sbjct: 113 LSSFNEAHPDIDVRLKAVDRLEDFLRDDV 141 >gnl|CDD|131842 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF. Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane. The gene for this periplasmic protein has been designated orf2 and ybgF. All members of the seed alignment were from unique tol-pal gene regions from completed bacterial genomes. The architecture of this protein is a signal sequence, a low-complexity region usually rich in Asn and Gln, a well-conserved region with tandem repeats that resemble the tetratricopeptide (TPR) repeat, involved in protein-protein interaction. Length = 119 Score = 26.9 bits (60), Expect = 1.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 35 IVKIGDHAESIKTLADFIKDYPD 57 ++K GD+A++I+ F+K YP Sbjct: 12 VLKAGDYADAIQAFQAFLKKYPK 34 Score = 26.5 bits (59), Expect = 1.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 36 VKIGDHAESIKTLADFIKDYPD 57 ++GD ++ TL IK YP Sbjct: 87 QELGDKEKAKATLQQVIKRYPG 108 >gnl|CDD|184456 PRK14018, PRK14018, trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional. Length = 521 Score = 26.4 bits (58), Expect = 1.8 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 10/56 (17%) Query: 5 IHLLNG--WGVNFRF--------LLDGYRSGKTSKDKYQKIVKIGDHAESIKTLAD 50 I+L G WG+ F + GY +G T Y+ + + HAE++K D Sbjct: 201 IYLAGGCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVYRHSGHAETVKVTYD 256 >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional. Length = 255 Score = 25.4 bits (56), Expect = 3.1 Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 22 YRSGKTSKDKYQKIVKIGDHAESIKTLADFIK 53 YRSG + + ++ + ++ L DFIK Sbjct: 216 YRSGLSVQQAVAELELQQFESPEVEELIDFIK 247 >gnl|CDD|183500 PRK12397, PRK12397, propionate kinase; Reviewed. Length = 404 Score = 25.6 bits (56), Expect = 3.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 26 KTSKDKYQKIVKIGDHAESIKTLADFIKDY 55 KT K+Q+ V + DH +++ L + + Y Sbjct: 46 KTHSQKWQETVPVADHRDAVTLLLEKLLGY 75 >gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional. Length = 275 Score = 25.0 bits (55), Expect = 4.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Query: 42 AESIKTLADFIKDYPDCDLELENLVTDD 69 A TLAD + Y D L L VTD Sbjct: 34 ARDTATLADLAEKYGDRLLPLALDVTDR 61 >gnl|CDD|161740 TIGR00169, leuB, 3-isopropylmalate dehydrogenase. This model will not find all isopropylmalate dehydrogenases; the enzyme from Sulfolobus sp. strain 7 is more similar to mitochondrial NAD-dependent isocitrate dehydrogenases than to other known isopropylmalate dehydrogenases and was omitted to improve the specificity of the model. It scores below the cutoff and below some enzymes known not to be isopropylmalate dehydrogenase. Length = 349 Score = 24.7 bits (54), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Query: 46 KTLADFIKDYPDCDLELENLVTD 68 KT+ + K+YP D+ELE+ D Sbjct: 200 KTVEEIAKEYP--DVELEHQYID 220 >gnl|CDD|178447 PLN02856, PLN02856, fumarylacetoacetase. Length = 424 Score = 24.3 bits (53), Expect = 8.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 48 LADFIKDYPDCDLELENL 65 L FI PD D ++NL Sbjct: 5 LKSFIDVAPDSDFPIQNL 22 >gnl|CDD|179506 PRK02939, PRK02939, lipoprotein; Reviewed. Length = 236 Score = 23.9 bits (52), Expect = 8.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 13 VNFRFLLDGYRSGKTSKDK 31 V +R+ +GY GKT+K Sbjct: 143 VEYRYDDEGYPLGKTTKSN 161 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.144 0.434 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,153,262 Number of extensions: 56053 Number of successful extensions: 169 Number of sequences better than 10.0: 1 Number of HSP's gapped: 169 Number of HSP's successfully gapped: 21 Length of query: 71 Length of database: 5,994,473 Length adjustment: 42 Effective length of query: 29 Effective length of database: 5,086,937 Effective search space: 147521173 Effective search space used: 147521173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)