BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 146 bits (369), Expect = 6e-38, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MKPIIHLLNGWGVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKDYPDCDL 60 MKPIIHLLNGWGVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKDYPDCDL Sbjct: 1 MKPIIHLLNGWGVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKDYPDCDL 60 Query: 61 ELENLVTDDIL 71 ELENLVTDDIL Sbjct: 61 ELENLVTDDIL 71 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 25.8 bits (55), Expect = 0.16, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 48 LADFIKDYPDCDLELENLVTDDI 70 L + + DYPDCD E+ + DD+ Sbjct: 144 LKESVIDYPDCDSEIMRGLDDDL 166 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 30 DKYQKIVKIGDHAESIKTLADFIKDY 55 DK +IG SI +L IKDY Sbjct: 9 DKRDASFRIGQFPSSIPSLDSSIKDY 34 >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 25.0 bits (53), Expect = 0.24, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 9/42 (21%) Query: 36 VKIGDHAESIKTLADFIKDYPD--------CD-LELENLVTD 68 V I + +IKT +D+++DYP CD ++L L+++ Sbjct: 58 VYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISE 99 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 12 GVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKDYPDCDL 60 GV+ L+ RS + + + +VK+GD D I D P DL Sbjct: 758 GVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRR----NDIIADGPSTDL 802 >gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 22.7 bits (47), Expect = 1.3, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 2 KPIIHLLNGWGVNFRF 17 KPI + L WG++ RF Sbjct: 22 KPITNSLKDWGMSHRF 37 >gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Score = 21.9 bits (45), Expect = 1.9, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 37 KIGDHAESIKTLADFIKDYPDCD 59 K+G SI+ + D IK PD + Sbjct: 191 KLGVATRSIREMLDIIKSIPDVN 213 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 21.9 bits (45), Expect = 2.1, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 32 YQKIVKIGDHAESIKTLADFIKDYPDCDLE 61 YQ I + +SI D+ KD+ CD++ Sbjct: 103 YQNIKVMRKQLQSIGLSIDWSKDFATCDVD 132 >gi|254780936|ref|YP_003065349.1| hypothetical protein CLIBASIA_04175 [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 21.2 bits (43), Expect = 3.1, Method: Compositional matrix adjust. Identities = 10/39 (25%), Positives = 17/39 (43%) Query: 10 GWGVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTL 48 G+ +++R LL +RS Y +GD + L Sbjct: 25 GFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPL 63 >gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 20.8 bits (42), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 20/43 (46%) Query: 12 GVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKD 54 G+ + D Y +G T+K + K G SI T + +KD Sbjct: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 13/24 (54%) Query: 35 IVKIGDHAESIKTLADFIKDYPDC 58 I I ++T A F+K +P+C Sbjct: 301 IASIDKKGRILRTNAHFLKLFPNC 324 >gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 30 DKYQKIVKIGDHAESIKTLADFIKDYPDCDLEL 62 D + +++K HA IKT+ F K + D +L Sbjct: 229 DSFFELLKAKSHALGIKTIYSFGKS-KNADFQL 260 >gi|254780468|ref|YP_003064881.1| sensory box/GGDEF family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 6/31 (19%) Query: 14 NFRFLLD---GYRSGKTSKDKYQKIVKIGDH 41 NFR +LD GYR G+ +Y+ V+ D+ Sbjct: 463 NFRTILDSFVGYRRGRL---QYEFRVRAADN 490 >gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Score = 20.0 bits (40), Expect = 7.0, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 22/41 (53%) Query: 2 KPIIHLLNGWGVNFRFLLDGYRSGKTSKDKYQKIVKIGDHA 42 K II L +G NF+ ++ + +K+ + KIV I +A Sbjct: 331 KFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINA 371 >gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 19.6 bits (39), Expect = 8.8, Method: Compositional matrix adjust. Identities = 8/29 (27%), Positives = 18/29 (62%) Query: 17 FLLDGYRSGKTSKDKYQKIVKIGDHAESI 45 ++L GYR+ +T+K ++ KI ++ + Sbjct: 125 YILSGYRTQETNKMLSRRNRKIARKSQHV 153 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.144 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,502 Number of Sequences: 1233 Number of extensions: 1656 Number of successful extensions: 18 Number of sequences better than 100.0: 17 Number of HSP's better than 100.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of query: 71 length of database: 328,796 effective HSP length: 42 effective length of query: 29 effective length of database: 277,010 effective search space: 8033290 effective search space used: 8033290 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 31 (16.5 bits)