HHsearch alignment for GI: 254781091 and conserved domain: TIGR01788

>TIGR01788 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR010107 This entry represents Glutamate decarboxylase (gad;) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms . Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium and Gram-positive bacterium . A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process.
Probab=99.68  E-value=3.2e-15  Score=111.92  Aligned_cols=334  Identities=18%  Similarity=0.233  Sum_probs=206.8

Q ss_pred             CCCCHHHHHHHHHHHH-HCCCCCHHHHHHHHHH-HHHHHHHHHHHHHCCCC--HHHE--EEE----CCHHHHHHHHHHHH
Q ss_conf             8989899999999996-4288523658999999-99999999999972989--7789--886----68538764455654
Q gi|254781091|r   13 APLLEVVRQSFVKSLD-FYGNPSSVHKEGQKTR-LYIEESRRIIADFCGAK--PDHV--VFT----SSATEAANWVLTPH   82 (383)
Q Consensus        13 tp~~~~v~~a~~~~~~-~~~n~~s~h~~~~~~~-~~~e~aR~~ia~~~g~~--~~ei--~ft----~~~T~a~~~~i~~~   82 (383)
T Consensus        59 Twme~EA~KLm~e~~~KN~ID~d-EYP---qTar~i~~RCVnM~a~LfhAp~~~D~~~~savGtsTiGSSEAiMLGGlAm  134 (493)
T TIGR01788        59 TWMEPEAEKLMDETLNKNMIDKD-EYP---QTAREIENRCVNMLADLFHAPALKDEEAASAVGTSTIGSSEAIMLGGLAM  134 (493)
T ss_pred             CCCCHHHHHHHHHCCCCCCCCCC-CCC---HHHHHHHHCCEEHHHHHHCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHH
T ss_conf             87776789999725577701100-165---44898850430123441147877787756643517732589999877775


Q ss_pred             --HHHCC----CC-CC--CCEEEECCCCCCCCCCCCCCCC----CCCCCCCCCC-C-CCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             --42102----24-56--6458733321221112222222----2222222222-2-21110234553244311356532
Q gi|254781091|r   83 --FYQGS----HK-IS--IDSLYISAIEHPAVYAGGHFPS----HKIHKIPVLS-K-GIVDIQALTDFLEQRNSTCGIPM  147 (383)
Q Consensus        83 --~~~~~----~~-~~--~~~ii~s~~eH~s~~~~~~~~~----~~v~~v~~~~-~-g~i~~~~l~~~i~~~t~~~~~~L  147 (383)
T Consensus       135 K~rWr~R~~~~Gk~~d~kKPNlv~g~~----vQVCWEKF~RYfdVE~R~VP~~~r~r~~i~Pe~~~~~vDENTIG----V  206 (493)
T TIGR01788       135 KWRWRKRMKAAGKPADAKKPNLVMGSN----VQVCWEKFARYFDVELREVPMDKRDRYVIDPEEVVDLVDENTIG----V  206 (493)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCEEECCC----CEEEECCCEEEEEEEEEEEECCCCCCCCCCHHHHHHHHCCCCCE----E
T ss_conf             799999998638887878872360798----61642122033554013672077776011889999860767524----8


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHCCC----------CCCCCCCCCCCCCCCCCC-----CC-----CC-----CCEEEEE
Q ss_conf             65403434443332112356520344----------653344432336554444-----43-----34-----3106873
Q gi|254781091|r  148 IAVMFVNNETGVIQPIKEIAQIVKEY----------QGILVVDAVQAAGRIPLS-----IE-----EI-----KADFLII  202 (383)
Q Consensus       148 Vs~~~~~n~tG~i~pi~~I~~~~~~~----------g~~~~vD~aqa~g~~~id-----~~-----~~-----~~D~~~~  202 (383)
T Consensus       207 ~~I-LG~TyTG~yE~v~~lnD~L~~~~~~~PDWsg~d~PiHvDAASGGFi~PFGfekehmk~~PDl~WDFRLprV~SINv  285 (493)
T TIGR01788       207 VAI-LGTTYTGEYEDVKALNDLLEELNAKTPDWSGWDIPIHVDAASGGFIAPFGFEKEHMKVEPDLEWDFRLPRVKSINV  285 (493)
T ss_pred             EEE-CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEECCCEEECCCCCCEEEECC
T ss_conf             887-4723258708889999999997427887477876647744678811376635341154571265661782468704


Q ss_pred             CCCCCC-CCCCCHHHHCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCHHHHHHCCC------CHHHHHHHHHH
Q ss_conf             054332-234320110145742012212-----247742122222221122210012211001------00245653210
Q gi|254781091|r  203 SSHKLG-APVGAGALVFREDILLPSPLL-----RGGDQEKGQRAGTENYAVIGGFAVAAQQMV------KDIQKRSSRVF  270 (383)
Q Consensus       203 S~hK~~-GP~G~G~L~~r~~~~~~~p~~-----~Gg~~e~~~~~GT~~~~~i~~~~~al~~~~------~~~~~~~~~~~  270 (383)
T Consensus       286 SGHKYGLvYPGvGWViWRd~e~LPeELiF~vnYLGg~~~t-F---tLNFSr-p~~qViaQYYnFlRLG~~GYr~i~q~~~  360 (493)
T TIGR01788       286 SGHKYGLVYPGVGWVIWRDEEALPEELIFHVNYLGGDEPT-F---TLNFSR-PANQVIAQYYNFLRLGREGYRKIMQNLL  360 (493)
T ss_pred             CCCCCCCCCCCCCEEEECCCCCCHHHCEEECCCCCCCCCC-C---CCCCCC-CCCCHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             6551246476612688758113701311101102665654-3---013557-6231136446688504013489999899


Q ss_pred             HHHHHHHHHHHHH--HHC-CCCCCCC-----------------------CCCCCCEEEEEECC--------CCHHHHHHH
Q ss_conf             1233334444432--100-0122322-----------------------11036522898579--------999999999
Q gi|254781091|r  271 AIRDYLEQELKKL--IPN-IIIYGKD-----------------------AERISNTCCFSIPF--------LKAEVLQIA  316 (383)
Q Consensus       271 ~L~~~l~~~l~~~--~~~-~~i~~~~-----------------------~~~~~~i~~~~~~~--------~~~~~v~~~  316 (383)
T Consensus       361 ~vA~~La~~~~~~sklPG~Fe~~s~g~~sienDsaPksvkDYWehPqaY~~~~-P~VaFrLKd~~~~~Y~~Yt~~~ls~~  439 (493)
T TIGR01788       361 DVAQYLAEEIAKLSKLPGPFEILSDGRESIENDSAPKSVKDYWEHPQAYKSGI-PLVAFRLKDDADEEYTGYTLYDLSHK  439 (493)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHCCCCCCCCCC-CEEEEECCCCCCCCCCCCCHHHHHHH
T ss_conf             99999999999860699845887178754334567740123313641227897-77988536877888876789999998


Q ss_pred             HHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCC---C-CEEEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             875896998711338864331014676288874---7-659999078889999999999999999862
Q gi|254781091|r  317 LDLEGIAVSAGSACSSGKIKKNHVLAAMGFDTS---Q-GAVRVSCGDSTTQEDIDIFLNALQKIIRTS  380 (383)
Q Consensus       317 l~~~gI~v~~G~~C~~~~~~~~~vl~~~g~~~~---~-g~vRiS~~~~nT~~dId~l~~~L~~iv~~~  380 (383)
T Consensus       440 LR~rGWiV------------PAYt---lP~~~~GsDd~~v~RiVvRe~~~~d~A~~Li~D~~~~~~~L  492 (493)
T TIGR01788       440 LRERGWIV------------PAYT---LPKNAEGSDDIEVLRIVVREDFSRDLAELLIEDLEKALAYL  492 (493)
T ss_pred             HHHCCCCC------------CCCC---CCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             50347313------------4788---84335677872799998725898406999999999999971