HHsearch alignment for GI: 254781091 and conserved domain: TIGR01979

>TIGR01979 sufS cysteine desulfurases, SufS subfamily; InterPro: IPR010970 Cysteine desulphurases are pyridoxal-phosphate enzymes which catalyse the removal of sulphur from L-cysteine to form L-alanine and elemental sulphur. These enzymes have been shown to play an important role in the biosynthesis of iron-sulphur clusters, thionucleosides in tRNA, thiamine, biotin, lipoate and molydopterin This entry represents a subfamily of NifS-related cysteine desulphurases that are often involved in iron-sulphur cluster formation, which is needed for nitrogen fixation and other vital functions . Many of these enzymes, in addition to cysteine desulphurase activity, also show selenocysteine lyase activity where L-selenocysteine is converted to L-alanine and selenide . Some of these enzymes are much more specific for selenocysteine than cysteine and are thus believed to function in selenium metabolism rather than sulphur metabolism. Structural studies of the E. coli and Synechocystis enzymes indicate that they are homodimers which show a similar fold to other members of the alpha family of pyridoxal-phosphate enzymes .; GO: 0030170 pyridoxal phosphate binding, 0031071 cysteine desulfurase activity, 0006534 cysteine metabolic process.
Probab=100.00  E-value=0  Score=734.96  Aligned_cols=360  Identities=28%  Similarity=0.413  Sum_probs=331.6

Q ss_pred             CCEECCCCCCCCCCHHHHHHHHHHHH-HCCCCC-HHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHEEEECCHHHHHHHHH
Q ss_conf             70012157888989899999999996-428852-365899999999999999999972989-778988668538764455
Q gi|254781091|r    3 KRVYLDWNATAPLLEVVRQSFVKSLD-FYGNPS-SVHKEGQKTRLYIEESRRIIADFCGAK-PDHVVFTSSATEAANWVL   79 (383)
Q Consensus         3 ~~iYlD~aattp~~~~v~~a~~~~~~-~~~n~~-s~h~~~~~~~~~~e~aR~~ia~~~g~~-~~ei~ft~~~T~a~~~~i   79 (383)
T Consensus        19 pLvYLDsAAT~QKP~~Vida~~~yY~~~nANVHRG~H~Ls~~AT~~YE~~R~kva~FiNA~~~~EIvFT~gtTe~iNLvA   98 (409)
T TIGR01979        19 PLVYLDSAATSQKPQAVIDAVEEYYRKSNANVHRGIHTLSVRATEAYEEAREKVAKFINAASAEEIVFTRGTTESINLVA   98 (409)
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHH
T ss_conf             41773485100284779999999987516700168999999999999999999998508899854787076027889999


Q ss_pred             HHHHHHCCCCCC----CCEEEECCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             654421022456----645873332122111222222----222222222222211102345532443113565326540
Q gi|254781091|r   80 TPHFYQGSHKIS----IDSLYISAIEHPAVYAGGHFP----SHKIHKIPVLSKGIVDIQALTDFLEQRNSTCGIPMIAVM  151 (383)
Q Consensus        80 ~~~~~~~~~~~~----~~~ii~s~~eH~s~~~~~~~~----~~~v~~v~~~~~g~i~~~~l~~~i~~~t~~~~~~LVs~~  151 (383)
T Consensus        99 ~s~--g~~~l~~av~pGDeIv~s~mEHHaNiVPWQ~l~~r~GA~lk~~~l~~~G~ld~~~l~~~~~~~T-----KlVa~~  171 (409)
T TIGR01979        99 YSW--GRSRLKAAVDPGDEIVISEMEHHANIVPWQLLAERTGATLKFIPLDDDGTLDLDDLEELLTEKT-----KLVAIT  171 (409)
T ss_pred             HHH--CCCCCHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHCCEEEEEECCCCCEEEHHHHHHHHHCCC-----EEEEEE
T ss_conf             983--1101342538988798401110012147999997609878997448876051888998832698-----299997


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCHHHHCCCCCCCCCCCCCC
Q ss_conf             34344433321123565203446533444323365544444334310687305433223432011014574201221224
Q gi|254781091|r  152 FVNNETGVIQPIKEIAQIVKEYQGILVVDAVQAAGRIPLSIEEIKADFLIISSHKLGAPVGAGALVFREDILLPSPLLRG  231 (383)
Q Consensus       152 ~~~n~tG~i~pi~~I~~~~~~~g~~~~vD~aqa~g~~~id~~~~~~D~~~~S~hK~~GP~G~G~L~~r~~~~~~~p~~~G  231 (383)
T Consensus       172 HvSNVlGtvnP~~ei~~~AH~~GA~vlvDGAQ~~pH~pvDv~~ldcDFyvFSGHKmyGPtGiGVLYGK~~lLe~MPPf~g  251 (409)
T TIGR01979       172 HVSNVLGTVNPVEEIIKLAHQVGAKVLVDGAQAVPHMPVDVQALDCDFYVFSGHKMYGPTGIGVLYGKEELLEEMPPFLG  251 (409)
T ss_pred             EEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHCCCEEEEECCHHHCCCCCEEEHHHHHHHHHCCCCCC
T ss_conf             42022030148789999986579769986255758989885655787445610045257663011278898864778466


Q ss_pred             CC-C---------------CCCCCCCCCCCCCCCCHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             77-4---------------21222222211222100122110010-0245653210123333444443210001223221
Q gi|254781091|r  232 GD-Q---------------EKGQRAGTENYAVIGGFAVAAQQMVK-DIQKRSSRVFAIRDYLEQELKKLIPNIIIYGKDA  294 (383)
Q Consensus       232 g~-~---------------e~~~~~GT~~~~~i~~~~~al~~~~~-~~~~~~~~~~~L~~~l~~~l~~~~~~~~i~~~~~  294 (383)
T Consensus       252 GG~MI~~V~~~~g~ty~~~P~KFEAGTPniagviGLgaAidYl~~iG~~~I~~~E~~L~~yal~~L~~-ipg~~iyGP~~  330 (409)
T TIGR01979       252 GGEMIEEVSLEEGTTYNEAPHKFEAGTPNIAGVIGLGAAIDYLEKIGLEKIEAHEKELTAYALERLGE-IPGLRIYGPRD  330 (409)
T ss_pred             CCCEEEEEEECCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CCCEEEECCCC
T ss_conf             98615788805771136787545688835899999999999985238789999999999999999601-89858746877


Q ss_pred             -CCCCCEEEEEECCCCHHHHHHHHHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             -1036522898579999999999875896998711338864331014676288874765999907888999999999999
Q gi|254781091|r  295 -ERISNTCCFSIPFLKAEVLQIALDLEGIAVSAGSACSSGKIKKNHVLAAMGFDTSQGAVRVSCGDSTTQEDIDIFLNAL  373 (383)
Q Consensus       295 -~~~~~i~~~~~~~~~~~~v~~~l~~~gI~v~~G~~C~~~~~~~~~vl~~~g~~~~~g~vRiS~~~~nT~~dId~l~~~L  373 (383)
T Consensus       331 ~~~R~g~isFn~~g~HpHDVg~~LD~~GiAvR~GHHCAqPlm~~~------~---v~atcRASf~~YNT~ediD~Lv~aL  401 (409)
T TIGR01979