Query         gi|254781092|ref|YP_003065505.1| hypothetical protein CLIBASIA_04970 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 35
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 00:39:36 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781092.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1t9i_A DNA endonuclease I-CREI   6.2      72   0.003   14.4  -0.6   20    1-20      1-20  (163)
  2 2hde_A Histone deacetylase com   3.7   2E+02  0.0082   12.3   0.2   15    4-18     19-34  (148)
  3 1t6a_A Rbstp2229 gene product;   3.6      90  0.0038   13.9  -1.6   17    5-21     97-113 (126)
  4 1iij_A ERBB-2 receptor protein   2.7 3.4E+02   0.014   11.2   0.5   15   11-25     19-33  (35)
  5 2a33_A Hypothetical protein; s   2.4 3.1E+02   0.013   11.4   0.1   10    4-13      8-20  (215)
  6 1a93_A Coiled coil, LZ, MYC pr   2.4 3.7E+02   0.016   11.0   1.6   18   15-32     12-29  (34)
  7 1wwr_A TRNA adenosine deaminas   2.3 3.8E+02   0.016   10.9   2.0   25   11-35    147-171 (171)
  8 1t07_A Hypothetical UPF0269 pr   2.3 2.3E+02  0.0096   12.0  -0.8   26    3-28      2-35  (94)
  9 3hkw_A NS5B RNA-dependent RNA    2.1   3E+02   0.013   11.4  -0.3    7    5-11    144-150 (581)
 10 3i1k_A Hemagglutinin-esterase    2.1 2.9E+02   0.012   11.5  -0.4    6   14-19     78-83  (377)

No 1  
>1t9i_A DNA endonuclease I-CREI; protein, hydrolase/DNA complex; HET: DNA; 1.60A {Chlamydomonas reinhardtii} SCOP: d.95.2.1 PDB: 1n3f_A* 1n3e_A* 1t9j_A* 1u0d_A* 1u0c_A* 2o7m_A* 2i3p_A* 1g9z_A* 1bp7_A* 1g9y_A* 2i3q_A* 2vbo_A* 2vbn_A* 2vbo_B* 2vbn_B* 2vbj_B* 2vbl_B* 2vbl_A* 2vbj_A* 1af5_A
Probab=6.23  E-value=72  Score=14.40  Aligned_cols=20  Identities=35%  Similarity=0.619  Sum_probs=8.3

Q ss_pred             CCCHHCCHHHEEEHHHHCCH
Q ss_conf             97001000111101012207
Q gi|254781092|r    1 MNTMKREKFCVFLILFYEGE   20 (35)
Q Consensus         1 mntmkrekfcvflilfyege   20 (35)
                      ||++..+.|.-++.=|.+||
T Consensus         1 m~~~~~~~~~~wiaGF~Dge   20 (163)
T 1t9i_A            1 MNTKYNKEFLLYLAGFVDGN   20 (163)
T ss_dssp             -CCCCCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHEEEEECE
T ss_conf             99765404445545479321


No 2  
>2hde_A Histone deacetylase complex subunit SAP18; HDAC, SIN3, GLI, bicoid, GAGA, transcriptional repressor; NMR {Homo sapiens}
Probab=3.69  E-value=2e+02  Score=12.31  Aligned_cols=15  Identities=33%  Similarity=0.583  Sum_probs=11.0

Q ss_pred             HHCCHHHEEEH-HHHC
Q ss_conf             01000111101-0122
Q gi|254781092|r    4 MKREKFCVFLI-LFYE   18 (35)
Q Consensus         4 mkrekfcvfli-lfye   18 (35)
                      ..|||-|-||+ +||.
T Consensus        19 IDRekTcPfLLRvF~~   34 (148)
T 2hde_A           19 IDREKTSPLLLRVFTT   34 (148)
T ss_dssp             CCTTTCCCEEEEEEEE
T ss_pred             CCCCCCCCEEEEEEEE
T ss_conf             6535678718999982


No 3  
>1t6a_A Rbstp2229 gene product; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: MSE; 2.05A {Geobacillus stearothermophilus} SCOP: d.129.8.1
Probab=3.57  E-value=90  Score=13.93  Aligned_cols=17  Identities=35%  Similarity=0.511  Sum_probs=12.6

Q ss_pred             HCCHHHEEEHHHHCCHH
Q ss_conf             10001111010122079
Q gi|254781092|r    5 KREKFCVFLILFYEGEL   21 (35)
Q Consensus         5 krekfcvflilfyegel   21 (35)
                      |-..||-||---++|||
T Consensus        97 KANEfckfLAK~L~geL  113 (126)
T 1t6a_A           97 KANEFSKWLAKTLGGEL  113 (126)
T ss_dssp             HHHHHHHHHHHHHCEEE
T ss_pred             HHHHHHHHHHHHHHCEE
T ss_conf             27689999999741015


No 4  
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1
Probab=2.67  E-value=3.4e+02  Score=11.19  Aligned_cols=15  Identities=47%  Similarity=0.702  Sum_probs=7.8

Q ss_pred             EEEHHHHCCHHHHHH
Q ss_conf             110101220799999
Q gi|254781092|r   11 VFLILFYEGELLVKR   25 (35)
Q Consensus        11 vflilfyegellvkr   25 (35)
                      .||||..--..|.||
T Consensus        19 lflilvvvvgilikr   33 (35)
T 1iij_A           19 LFLILVVVVGILIKR   33 (35)
T ss_dssp             HHHHHTTTTTHHHHH
T ss_pred             HHHHHHHHHHHHEEE
T ss_conf             999999998861240


No 5  
>2a33_A Hypothetical protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT2G37210; 1.95A {Arabidopsis thaliana} SCOP: c.129.1.1 PDB: 2q4o_A
Probab=2.41  E-value=3.1e+02  Score=11.35  Aligned_cols=10  Identities=60%  Similarity=1.308  Sum_probs=4.4

Q ss_pred             HHCCHH---HEEE
Q ss_conf             010001---1110
Q gi|254781092|r    4 MKREKF---CVFL   13 (35)
Q Consensus         4 mkrekf---cvfl   13 (35)
                      |+|+|+   |||.
T Consensus         8 ~~~~~~k~V~VF~   20 (215)
T 2a33_A            8 MQKSKFRRICVFC   20 (215)
T ss_dssp             CCCCSCSEEEEEC
T ss_pred             HHHCCCCEEEEEC
T ss_conf             5333685399988


No 6  
>1a93_A Coiled coil, LZ, MYC proto-oncogene protein; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Homo sapiens} SCOP: h.1.3.1 PDB: 2a93_A
Probab=2.40  E-value=3.7e+02  Score=10.98  Aligned_cols=18  Identities=44%  Similarity=0.449  Sum_probs=13.3

Q ss_pred             HHHCCHHHHHHHHHHHHH
Q ss_conf             012207999999634552
Q gi|254781092|r   15 LFYEGELLVKRFMHTKKK   32 (35)
Q Consensus        15 lfyegellvkrfmhtkkk   32 (35)
                      |.-|..||-||--|-|.|
T Consensus        12 l~se~dllrkrre~lkhk   29 (34)
T 1a93_A           12 LISEEDLLRKRREQLKHK   29 (34)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHHHH
T ss_conf             712899999999999999


No 7  
>1wwr_A TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} SCOP: c.97.1.2
Probab=2.31  E-value=3.8e+02  Score=10.91  Aligned_cols=25  Identities=20%  Similarity=0.258  Sum_probs=17.7

Q ss_pred             EEEHHHHCCHHHHHHHHHHHHHCCC
Q ss_conf             1101012207999999634552169
Q gi|254781092|r   11 VFLILFYEGELLVKRFMHTKKKNIV   35 (35)
Q Consensus        11 vflilfyegellvkrfmhtkkkniv   35 (35)
                      +.-++.-|..-|.++|...+.+||.
T Consensus       147 v~~g~~eE~~~Ll~~FF~~~R~~~~  171 (171)
T 1wwr_A          147 WEYYPLEEASELLSEFFKKLRNNII  171 (171)
T ss_dssp             EEECCCHHHHHHHHHHHHHHHHTCC
T ss_pred             EEEECHHHHHHHHHHHHHHHHHCCC
T ss_conf             9973499999999999999862069


No 8  
>1t07_A Hypothetical UPF0269 protein PA5148; structural genomics, APC5047, conserved hypothetical protein, PSI, protein structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa} SCOP: d.279.1.1
Probab=2.26  E-value=2.3e+02  Score=11.99  Aligned_cols=26  Identities=19%  Similarity=0.184  Sum_probs=14.7

Q ss_pred             CHHCCHHHEEEH--------HHHCCHHHHHHHHH
Q ss_conf             001000111101--------01220799999963
Q gi|254781092|r    3 TMKREKFCVFLI--------LFYEGELLVKRFMH   28 (35)
Q Consensus         3 tmkrekfcvfli--------lfyegellvkrfmh   28 (35)
                      .|.|.-||+++-        --|-|++=-+-|-+
T Consensus         2 ~M~r~V~C~k~~ke~~gLd~pP~PG~lG~~I~~~   35 (94)
T 1t07_A            2 HMSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNN   35 (94)
T ss_dssp             CCCCEEEETTTTEEEEBCSSCSSSSHHHHHHHHH
T ss_pred             CCCCEEEEHHHCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             9873662187288366888899995878999999


No 9  
>3hkw_A NS5B RNA-dependent RNA polymerase; HCV polymerase, 1,5-benzodiazepine, transferase; HET: IX6; 1.55A {Hepatitis c virus subtype 1A} PDB: 2xi3_A* 2xi2_A* 3e51_A* 3bsa_A* 3bsc_A* 3br9_A* 3co9_A* 3cvk_A* 3cwj_A* 3d28_A* 3d5m_A* 3cde_A* 3gyn_A* 3h2l_A* 3igv_A* 2ax0_A* 2awz_A* 2ax1_A* 1os5_A* 2jc1_A* ...
Probab=2.10  E-value=3e+02  Score=11.41  Aligned_cols=7  Identities=71%  Similarity=1.298  Sum_probs=0.0

Q ss_pred             HCCHHHE
Q ss_conf             1000111
Q gi|254781092|r    5 KREKFCV   11 (35)
Q Consensus         5 krekfcv   11 (35)
                      |+|+|||
T Consensus       144 KnEVF~v  150 (581)
T 3hkw_A          144 KNEVFCV  150 (581)
T ss_dssp             CCCEEEC
T ss_pred             CCEEEEE
T ss_conf             3346860


No 10 
>3i1k_A Hemagglutinin-esterase protein; SGNH-hydrolase fold, swiss roll, envelope protein, glycoprotein, membrane, transmembrane, virion; HET: NAG; 2.10A {Porcine torovirus} PDB: 3i1l_A*
Probab=2.09  E-value=2.9e+02  Score=11.46  Aligned_cols=6  Identities=67%  Similarity=1.370  Sum_probs=0.0

Q ss_pred             HHHHCC
Q ss_conf             101220
Q gi|254781092|r   14 ILFYEG   19 (35)
Q Consensus        14 ilfyeg   19 (35)
                      |+||||
T Consensus        78 ~iFYEG   83 (377)
T 3i1k_A           78 KVFYEG   83 (377)
T ss_dssp             EEEECC
T ss_pred             EEEECC
T ss_conf             999644


Done!