HHsearch alignment for GI: 254781094 and conserved domain: PRK00106

>PRK00106 hypothetical protein; Provisional.
Probab=97.99  E-value=0.00012  Score=50.93  Aligned_cols=111  Identities=29%  Similarity=0.331  Sum_probs=91.9

Q ss_pred             CCCCHHHHHHHHCCCCEEHHHHHH-HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             137889988421002303134551-3899898999999998865299988999999974236788898403457899999
Q gi|254781094|r  361 LSKPLDQRMARLDMLDVVFHAKIG-TQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGK  439 (702)
Q Consensus       361 lk~~L~~~~~~L~~~~v~F~~~LG-s~~dK~~Ri~~la~~la~~l~~~~~~~~rAa~L~KaDL~t~mV~EFpeLQG~mG~  439 (702)
T Consensus       330 lhpelik~lGrLk-----yRtSygQNvL~HS~Eva~lag~mA~ElG~d~~~AkRagLLH--DIGKa~d~e~egsH~~iG~  402 (535)
T PRK00106        330 LHPDLIKIMGRLQ-----FRTSYGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLH--DMGKAIDREVEGSHVEIGM  402 (535)
T ss_pred             CCHHHHHHHHHHC-----CHHHCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH--HCCCCCCCCCCCCHHHHHH
T ss_conf             9978999987600-----01024058999999999999999998399999999998765--1014566767898799999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99862369988999999973447767778863588999999749
Q gi|254781094|r  440 EYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKL  483 (702)
Q Consensus       440 ~YA~~~ge~~~Va~aI~ehY~P~~~~d~lP~~~~g~ilsiaDKl  483 (702)
T Consensus       403 ~lakky~E~~~VinaI~aHH-----~d~~~~s~~a~lV~aADai  441 (535)
T PRK00106        403 EFARKYKEHPVVVNTIASHH-----GDVEPDSVIAVIVAAADAL  441 (535)
T ss_pred             HHHHHCCCCHHHHHHHHHHC-----CCCCCCCHHHHHHHHHHHH
T ss_conf             99998399879999999827-----8888854888999999998