HHsearch alignment of GI: 254781094 and MMDB domain: 1f7u_A_116-136_513-607

>1f7u_A (A:116-136,A:513-607) Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae}
Probab=99.40  E-value=2.6e-12  Score=102.86  Aligned_cols=102  Identities=14%  Similarity=0.212  Sum_probs=91.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCH
Q ss_conf             99985565312467777738568359899999999999999999985025389999999853278887510270368868
Q gi|254781094|r  596 IFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDR  675 (702)
Q Consensus       596 v~NIL~~~~k~~~~~~~~vd~~Lf~~~~Ek~L~~~~~~~~~~i~~~l~~~dy~~~L~~L~~L~~~Id~FFDnVmVm~eD~  675 (702)
                      +-.|+..    ..++..++|+++|++++|++|+..+......+..+..+.+|..++..+..|.+.++.|||+|+||++|+
T Consensus         9 ~~~~~~~----~~~~~~~iD~~lL~~~~E~~L~~~l~~~~~~i~~a~~~~~p~~l~~yL~~La~~fn~fy~~v~Vl~ed~   84 (116)
T 1f7u_A            9 IPDILTR----KEDYGSNADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVSSCYDVLWVAGQTE   84 (116)
T ss_dssp             HHHHHHH----GGGTTCTSCGGGCCSHHHHHHHHHHTTHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCSTTSCH
T ss_pred             HHHHHHC----CCCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             9999856----511398466000499999999999998999999999768989999999999999999987265778988


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHC
Q ss_conf             99999999999999999860684521
Q gi|254781094|r  676 EVRDNRLSLLQYIKNIILIVINVQKI  701 (702)
Q Consensus       676 ~IR~NRL~LL~~i~~~f~~iaDfs~L  701 (702)
                      .+|+|||+|++.++..+....|+--|
T Consensus        85 ~i~~aRL~Ll~av~~vl~~~l~lLGI  110 (116)
T 1f7u_A           85 ELATARLALYGAARQVLYNGMRLLGL  110 (116)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             89999999999999999998785297