HHsearch results for GI: 254781094 and protein with PDBid: 3gw7_A

>3gw7_A Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12}
Probab=96.27  E-value=0.0062  Score=37.74  Aligned_cols=172  Identities=18%  Similarity=0.192  Sum_probs=93.0

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH-H--HHHHHHCCHHHHHHHHHHHHHH--CCCC----HHHHHHHHH
Q ss_conf             99898999999998865299988999999974236-7--8889840345789999999862--3699----889999999
Q gi|254781094|r  387 GERVSRIRVLGKKIAQLIDADVALVDRAIVLSKAD-L--CTEIVREFPELQGKIGKEYAVL--QNEN----ISCCDAIEE  457 (702)
Q Consensus       387 ~dK~~Ri~~la~~la~~l~~~~~~~~rAa~L~KaD-L--~t~mV~EFpeLQG~mG~~YA~~--~ge~----~~Va~aI~e  457 (702)
                      ++-+.|+..+|..|+..-+.|...+.-||+|==.. .  .+.--..-....+.+.......  .|.+    ..|+.+|..
T Consensus        27 ~~Hi~RV~~~A~~Ia~~e~~D~~vv~lAALLHDIg~~k~~~~~~~~~~~~~a~~a~~lL~~~~~~~~~~~i~~I~~aI~~  106 (239)
T 3gw7_A           27 VCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEETRRLLREEFEQFPAEKIEAVCHAIAA  106 (239)
T ss_dssp             CCHHHHHHHHHHHHTTTSCSCTTHHHHHHHHTTTTC--------CCSSHHHHHHHHHHHHHHTTSSCTTTTTSTTTGGGS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             89999999999999987498899999999972455100268832047888999999999865138999999999999997


Q ss_pred             HHCCCCCCCCCCCCHHHHHHHHHHHHHHHH-----HHHHC----CCCCCCCCCHHHHHHHHHHH---HHHHHHCCCCCCH
Q ss_conf             734477677788635889999997499898-----76510----56768776968888743446---8999837997887
Q gi|254781094|r  458 HLKPRGPLENVPTNKISITVSLADKLDTLI-----NFWAI----NEKPSGSKDPYALRRATLGI---IRIILENKIDIPL  525 (702)
Q Consensus       458 hY~P~~~~d~lP~~~~g~ilsiaDKlDtl~-----g~f~i----g~~PTGS~DPfaLRR~a~Gi---irIl~e~~l~l~l  525 (702)
                      |   .++...-|.|+.+.||.-|||||.|=     =+|..    |.......||++..|..-..   |.=.-++-+.|  
T Consensus       107 H---s~~~~~~~~t~Ea~IVqDADrLDalGAiGIaR~f~~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~Hf~eKL~~L--  181 (239)
T 3gw7_A          107 H---SFSAQIAPLTTEAKIVQDADRLEALGAIGLARVFAVSGALGVALFDGEDPFAQHRPLDDKRYALDHFQTKLLKL--  181 (239)
T ss_dssp             S---CTTSCCCCCSHHHHHHHHHTGGGGSHHHHHHHHHHHHHHTTCCCSGGGGGGGTSCCCCC--CHHHHHTTTGGGT--
T ss_pred             H---CCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHH--
T ss_conf             1---58789998888999999878885310478999999811247766686420332055342788999999999967--


Q ss_pred             HHHHHH-------HHHHHHHH---HHHHHHHH--HCCCCHHHHHHHHHCC
Q ss_conf             896303-------64999999---99999876--3388878998854168
Q gi|254781094|r  526 SQFIED-------QNLILFFH---DRLKLYLH--DRDIRHDLIEAILRPE  563 (702)
Q Consensus       526 ~~li~~-------~~l~~Fi~---~Rl~~~L~--e~G~~~DiI~AVl~~~  563 (702)
                      .+.+.-       +.=..|+.   +++..-+.  ..|.++.++++--+.+
T Consensus       182 ~~~m~T~tgr~iA~~R~~~m~~Fl~~~~~E~~g~~~~~~~~~~~~~~~~~  231 (239)
T 3gw7_A          182 PQTMQTARGKQLAQHNAHFLVEFMAKLSAELAGENEGVDHKVIDAFSSAG  231 (239)
T ss_dssp             TTTCCSHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSSCCTTTHHHHSCTT
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCC
T ss_conf             98688989999999999999999999999978572147799998721203