BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit
beta [Candidatus Liberibacter asiaticus str. psy62]
         (702 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|241203330|ref|YP_002974426.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857220|gb|ACS54887.1| glycyl-tRNA synthetase, beta subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 704

 Score =  728 bits (1879), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/702 (53%), Positives = 493/702 (70%), Gaps = 1/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPKKGDFYVAVISKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVSDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIVCTFGPEHEETTVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+  D Y  +LE+A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGITASNITYGHRFHAPEAITVRRFDDYAANLEKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-L 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + G  L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRPQGGETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNIQASDGG  IV GN +VV ARL DALHFWKRDQ NLP+L +L+ SA KF L
Sbjct: 301 SNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLEASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L K++A +  AD AL+DRA VL+K
Sbjct: 361 DLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRTLAKELADITGADAALIDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YAVLQ E+ S   AIE+H KP+GP + VP ++++IT++L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAVLQGEDASVAAAIEDHYKPQGPSDRVPEDRVAITIAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTLI FWAI+EKP+GSKDP+ALRRA LG++RI+LE +I +PL    +D +L+ FFH
Sbjct: 481 ADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRILLERRIRLPLLATTKDGDLLSFFH 540

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  RHDLI+A+L  + D+LL +   ++ L  F +S  G+  L   KR  Q+
Sbjct: 541 DRLKVYLRDQGARHDLIDAVLTSDADDLLMVARRVEALTAFITSEDGKNLLSGTKRATQL 600

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   I+  +SP  L L+AEK L+A IS       +++  + +    + L  +  
Sbjct: 601 LAAEEKKGTVIADGVSPALLTLDAEKELFAAISGASKDASDAVAGEDFRSAMEALSKLRG 660

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 PVDRFFEDVLVNDEDAAIRANRLALLRLIREATGTVADFSKI 702


>gi|327190722|gb|EGE57803.1| glycyl-tRNA synthetase protein, beta subunit [Rhizobium etli
           CNPAF512]
          Length = 704

 Score =  728 bits (1879), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/702 (53%), Positives = 490/702 (69%), Gaps = 1/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPKKGDFYVAVISKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVAEVMPGIIRDFPWPKSMRWGKASSKSGALRWVRPLQSIVCTFGPEHEETTVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+  D Y   LE+A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGIIASNITYGHRFHAPEAITVRRFDDYAASLEKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + EG L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRRQGEGTL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNIQA DGG  IV GN +VV ARL DALHFWKRDQ NLP+L +L  SA KF L
Sbjct: 301 SNRFILVSNIQAHDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLGASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L K++A +  AD AL DRA VL+K
Sbjct: 361 DLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAKELAAITGADPALTDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YAVLQ EN S   A+E+H KP+GP + VP +K++IT++L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAVLQGENASVAAAVEDHYKPQGPSDRVPEDKVAITLAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTL  FWAI+EKP+GSKDP+ALRRA LG++RI+LE ++ +PL     D +L+ FFH
Sbjct: 481 ADKLDTLTGFWAIDEKPTGSKDPFALRRAALGVVRILLERRVRLPLLATTRDGDLLSFFH 540

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  R+DLI+A+L P+ D+LL +   ++ L  F +S  G+  L   KR  Q+
Sbjct: 541 DRLKVYLRDQGARYDLIDAVLTPDADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQL 600

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   I+  +SP  L L+AEK L++ IS       +++  + +    + L  +  
Sbjct: 601 LAAEEKKGTVIADGVSPALLKLDAEKELFSAISSASKDAADAVAGEDFRSAMEALSKLRG 660

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF++VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 PVDRFFEEVLVNDEDAAIRANRLALLRLIREATGTVADFSKI 702


>gi|86356536|ref|YP_468428.1| glycyl-tRNA synthetase subunit beta [Rhizobium etli CFN 42]
 gi|123512853|sp|Q2KBT5|SYGB_RHIEC RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|86280638|gb|ABC89701.1| glycyl-tRNA synthetase, beta subunit protein [Rhizobium etli CFN
           42]
          Length = 704

 Score =  727 bits (1878), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/702 (53%), Positives = 484/702 (68%), Gaps = 1/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL +IS+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSISEAQVVNDPKKGDFYVAVISKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVAEVMPGIIRDFPWPKSMRWGKASSAPGALRWVRPLQSIVCTFGPEHEETTVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+  D Y   LE A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGITASNITYGHRFHAPEAIMVRRFDDYAASLERAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + E  L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRKQGEDTL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNI+ASDGG  IV GN +VV ARL DALHFWKRDQ NLP+L +L  SA KF L
Sbjct: 301 SNRFILVSNIEASDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLAASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L +K+A +  AD AL DRA VL+K
Sbjct: 361 DLQKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAQKLAAVTGADAALTDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YA LQ EN S   AIE+H KP+GP + VP +K++IT++L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAALQGENASVAAAIEDHYKPQGPSDRVPEDKVAITLAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTL  FWAI+EKP+GSKDP+ALRRA LG++RI+LE  I +PL     D +L+ FFH
Sbjct: 481 ADKLDTLTGFWAIDEKPTGSKDPFALRRAALGVVRILLERGIRLPLLATTRDGDLLSFFH 540

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  RHDLI+A+L PE D+LL +   ++ L  F +S  G+  L   KR  Q+
Sbjct: 541 DRLKVYLRDQGARHDLIDAVLTPEADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQL 600

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   I+  +SP    L+AEK L+A IS        ++  + +    + L  +  
Sbjct: 601 LAAEEKKGTVIADGVSPALFKLDAEKELFAAISSASKDAANAVAGEDFRSAMEALSKLRG 660

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 PVDRFFEDVLVNDEDAAIRANRLALLRLIREATGTVADFSKI 702


>gi|116250725|ref|YP_766563.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|229558570|sp|Q1MKQ6|SYGB_RHIL3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|115255373|emb|CAK06448.1| putative glycyl-tRNA synthetase beta chain [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 704

 Score =  726 bits (1873), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/702 (53%), Positives = 492/702 (70%), Gaps = 1/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPKKGDFYVAVISKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVTDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIVCTFGPEHEETTVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP PI V+  D Y  +LE+A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGITASNITYGHRFHAPEPITVRRFDDYAANLEKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-L 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + G  L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRPQGGETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNIQASDGG  IV GN +VV ARL DALHFWKRDQ NLP+L +L  SA KF L
Sbjct: 301 SNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLTASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           D++KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L K++A +  AD AL+DRA VL+K
Sbjct: 361 DINKPLDQRMAKLDALDVTFHAKLGTQGARVARIRTLAKQLADITGADAALIDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YA LQ E+ S   A+E+H KP+GP + VP ++++IT++L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAALQGEDASVAAALEDHYKPQGPSDRVPEDRVAITIAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTLI FWAI+EKP+GSKDP+ALRRA LG++RI+LE K+ +PL     D +L+ FFH
Sbjct: 481 ADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRILLERKVRLPLLTTTRDIDLLSFFH 540

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  RHDLI+A+L P+ D+LL +   ++ L  F +S  G+  L   KR  Q+
Sbjct: 541 DRLKVYLRDQGARHDLIDAVLTPDADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQL 600

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   I+  +S   L L+AEK L+A IS       +++  + +    + L  +  
Sbjct: 601 LAAEEKKGTVIADGVSQALLKLDAEKELFAAISGASKDASDAVAGEDFRSAMEALSKLRG 660

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 PVDRFFEDVLVNDEDAAIRANRLALLRLIREATGTVADFSKI 702


>gi|190890601|ref|YP_001977143.1| glycyl-tRNA synthetase, beta subunit [Rhizobium etli CIAT 652]
 gi|238692499|sp|B3PRI2|SYGB_RHIE6 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|190695880|gb|ACE89965.1| glycyl-tRNA synthetase protein, beta subunit [Rhizobium etli CIAT
           652]
          Length = 704

 Score =  724 bits (1869), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/702 (53%), Positives = 489/702 (69%), Gaps = 1/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPKKGDFYVAVISKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVAEVMPGIIRDFPWPKSMRWGKASSKSGALRWVRPLQSIVCTFGPEHEETTVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+  D Y   LE+A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGITASNITYGHRFHAPEAITVRRFDDYAASLEKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + E  L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRKQGEDTL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNIQA DGG  IV GN +VV ARL DALHFWKRDQ NLP+L +L  SA KF L
Sbjct: 301 SNRFILVSNIQAHDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLAASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L K++A +  AD AL DRA VL+K
Sbjct: 361 DLQKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAKELAAITGADPALTDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YAVLQ EN S   A+E+H KP+GP + VP +K++IT++L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAVLQGENASVAAAVEDHYKPQGPSDRVPEDKVAITLAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTL  FWAI+EKP+GSKDP+ALRRA LG++RI+LE ++ +PL     D +L+ FFH
Sbjct: 481 ADKLDTLTGFWAIDEKPTGSKDPFALRRAALGVVRILLERRVRLPLLATTRDGDLLSFFH 540

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  R+DLI+A+L P+ D+LL +   ++ L  F +S  G+  L   KR  Q+
Sbjct: 541 DRLKVYLRDQGARYDLIDAVLTPDADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQL 600

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   I+  +SP  L L+AEK L+A IS       +++  + +    + L  +  
Sbjct: 601 LAAEEKKGTVIADGVSPALLKLDAEKELFAAISSASKDAADAVAGEDFRSAMEALSKLRG 660

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF++VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 PVDRFFEEVLVNDEDAAIRANRLALLRLIREATGTVADFSKI 702


>gi|319784744|ref|YP_004144220.1| glycyl-tRNA synthetase subunit beta [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170632|gb|ADV14170.1| glycyl-tRNA synthetase, beta subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 706

 Score =  719 bits (1855), Expect = 0.0,   Method: Composition-based stats.
 Identities = 351/704 (49%), Positives = 473/704 (67%), Gaps = 3/704 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  +L   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLRKMLTDSLVEAGLTYEAAREYWTPRRLTLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE  GP   A ++A+ GFLR  GL +I++  +  DPKKGD Y+A + KP R  
Sbjct: 61  ARSKDINEEIKGPSTSAPEQAVQGFLRKAGLSSIAEAHVHSDPKKGDFYVAHISKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E ++  +VP  I+  PWPKSMRW  + +   +  W+RPL+SILC    E  +  +ID ++
Sbjct: 121 EQIIAELVPGIIRNFPWPKSMRWGPSSAKPGSLRWVRPLQSILCTFGPETEEPVVIDFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GNITYGHRFHAP  I V+  D Y+  LE A V+LD + R+  IL DA  LA A G
Sbjct: 181 DGIRSGNITYGHRFHAPDAITVRRFDDYVSKLEAAKVVLDADRRKEIILADARNLAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EGV 298
           L+LVED+ LLEE+ GLVEW  V MG F++ +L +P E+IRLTI+ NQKCFVTR +  +  
Sbjct: 241 LDLVEDEGLLEEVSGLVEWPVVLMGEFEEAFLAIPAEVIRLTIRANQKCFVTRPQGVDDA 300

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L+N FIL +NI+A DGG  I  GN +VV ARL DAL+FW  DQ +LP+L+ L+ SA KF 
Sbjct: 301 LSNRFILTANIEARDGGKEIAHGNGKVVRARLSDALYFWTTDQGDLPDLAELEASAEKFG 360

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
           LDL KPLDQRMARLD L V FHAK+GTQGERV RI+ L +++A ++ AD AL  RA VL+
Sbjct: 361 LDLKKPLDQRMARLDHLGVTFHAKLGTQGERVERIKRLAEELAPIVGADPALARRAAVLA 420

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           KADL TE+V EFPELQG +G++YA+LQ E+ S   A EEH KP+GP + V ++ +SITV+
Sbjct: 421 KADLTTEVVGEFPELQGAMGRKYALLQGEHASVAAAAEEHYKPQGPSDRVSSDPVSITVA 480

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-EDQNLILF 537
           LADKLD L+ FWAI+EKP+GSKDPYALRRA LG++RI++EN I + L+  + +  +L+ F
Sbjct: 481 LADKLDMLVGFWAIDEKPTGSKDPYALRRAALGVVRILVENDIRLALAAIVGKASDLLSF 540

Query: 538 FHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIF 597
           FHDRLK+YL D+  RHDLI+A++ P++D+LL IV  ++ L  F  +  G+  L   KR  
Sbjct: 541 FHDRLKVYLRDQGARHDLIDAVITPQSDDLLQIVRRVEALGAFLDTEDGKNLLAGTKRAA 600

Query: 598 QILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSI 657
            ILA EEKK   ++  + P     + EK L+A ++       E++ +  +      L  +
Sbjct: 601 NILAAEEKKKTAVAETVEPALFRADTEKSLFAAVNQAEKQAGEAIQNDDFSGALLALSVL 660

Query: 658 CEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            EP++ FF+ VLVN +D+ VR NRL+LL  I+     V +  +I
Sbjct: 661 REPVDSFFEHVLVNDEDQAVRANRLALLARIRAATGQVADFSRI 704


>gi|13476182|ref|NP_107752.1| glycyl-tRNA synthetase subunit beta [Mesorhizobium loti MAFF303099]
 gi|25009337|sp|Q986B5|SYGB_RHILO RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|14026942|dbj|BAB53538.1| glycyl-tRNA synthetase, beta chain [Mesorhizobium loti MAFF303099]
          Length = 718

 Score =  719 bits (1855), Expect = 0.0,   Method: Composition-based stats.
 Identities = 353/716 (49%), Positives = 475/716 (66%), Gaps = 15/716 (2%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  +L   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKMLTDGLVEAGLTYEAAREYWTPRRLTLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE  GP   A ++A+ GFLR  GL +++D  +  DPKKGD Y+A + KP R  
Sbjct: 61  ARSKDIREEIKGPSTTAPEQAVQGFLRKAGLSSVADAHVHSDPKKGDFYVAHISKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  +VP  I+  PWPKSMRW    +   +  W+RPL+S+LC    E  +  ++D ++
Sbjct: 121 EEIIAQLVPGIIRNFPWPKSMRWGPASAKPGSLRWVRPLQSVLCTFGPETEEPVVVDFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GNITYGHRF AP  I V+  D Y+  LE A V+LD + R+  IL DA  LA A G
Sbjct: 181 DGIRSGNITYGHRFLAPGEITVRRFDDYVSKLEAAKVVLDADRRKEIILADARNLAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-- 298
           L+LVED+ LLEE+ GLVEW  V MG F++ +L +P E+IRLTI+ NQKCFVTR +     
Sbjct: 241 LDLVEDEGLLEEVSGLVEWPVVLMGEFEEAFLAIPAEVIRLTIRANQKCFVTRPQGEGEA 300

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L+N FIL SNI+A DGG  I  GN +VV ARL DAL+FW  DQ +LP+L  L+ SA KF 
Sbjct: 301 LSNRFILTSNIEARDGGKEIAHGNGKVVRARLSDALYFWTTDQGDLPDLGQLEASAEKFG 360

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
           LDL+KPLDQRMARLD L+V FHAK+GTQGERV RIR L +++A  + AD  L  RA VL+
Sbjct: 361 LDLNKPLDQRMARLDHLNVTFHAKLGTQGERVERIRRLAEELAPTVGADPVLAARAAVLA 420

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           KADL TE+V EFPELQG +G++YA+LQ E+ S   AIEEH KP+GP + VP++ +S+ V+
Sbjct: 421 KADLQTEVVGEFPELQGAMGRKYALLQGEHPSVAAAIEEHYKPQGPSDYVPSDPVSVAVA 480

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI--------- 529
           LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG++RI++E++I + LS            
Sbjct: 481 LADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVVRILVEDRIQLRLSSIFASAGACYAG 540

Query: 530 ----EDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAK 585
               + ++L+ FFHDRLK+YL D+  RHDLI+A++ P++D+LL IV  ++ L  F  +  
Sbjct: 541 SGADQTRDLLAFFHDRLKVYLRDQGARHDLIDAVITPQSDDLLQIVRRVEALGSFLDTED 600

Query: 586 GEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHK 645
           G+  L   KR   ILA EEKK   ++  + P      AEK L+A ++       E++ ++
Sbjct: 601 GKNLLAGTKRAANILAAEEKKKTAVAKTVEPALFKENAEKSLFAAVNQAEKQAGEAIQNE 660

Query: 646 RYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            +      L ++ EP++ FF+ VLVN +D EVR NRL+LL  I+     V +  KI
Sbjct: 661 DFSAAMLALSALREPVDSFFEGVLVNDEDLEVRANRLALLTRIRAATGQVADFSKI 716


>gi|222085067|ref|YP_002543597.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84]
 gi|221722515|gb|ACM25671.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84]
          Length = 742

 Score =  717 bits (1852), Expect = 0.0,   Method: Composition-based stats.
 Identities = 366/740 (49%), Positives = 494/740 (66%), Gaps = 39/740 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+ +R+YWTP RL L ++G++
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGVREYWTPRRLTLDIRGVT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q++ DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVQSDPKKGDFYVAVISKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    +   +  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVADVMPWIIRDFPWPKSMRWGKASAKPGSLRWVRPLQSIVCTFGTEHEETVVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   N+TYGHRFHAP PI V+  D Y+  L++A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGIVASNVTYGHRFHAPGPITVKRFDDYVSSLDKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTRE---- 296
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR ++    
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRRQDSHLP 300

Query: 297 -----------------------------------GVLANCFILVSNIQASDGGAAIVQG 321
                                              G L+N FILVSNIQA+DGG  I+ G
Sbjct: 301 LNGGGRSEAAGGGDPLLQQNHPTPALRANPPPQGEGALSNRFILVSNIQATDGGKEIIHG 360

Query: 322 NSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHA 381
           N +VV ARL DALHFWKRDQ +LP+L +L+ SA KF LDL KPLDQRMA+LD L+V FHA
Sbjct: 361 NGKVVRARLSDALHFWKRDQGDLPDLETLEASAAKFGLDLKKPLDQRMAKLDALNVTFHA 420

Query: 382 KIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEY 441
           K+G+QGERV+RIR L  ++A++  AD   VDRA VL+KADL TE V EFPELQG +G++Y
Sbjct: 421 KLGSQGERVARIRTLAAELAKITGADPLKVDRAAVLAKADLRTEAVGEFPELQGLMGRKY 480

Query: 442 AVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKD 501
           A LQ E+ S   AIE+H KP+GP + VP +K++ITV+LADKLDTL+ FWAI+EKP+GSKD
Sbjct: 481 AALQGEDASVAAAIEDHYKPQGPSDRVPDDKVAITVALADKLDTLMGFWAIDEKPTGSKD 540

Query: 502 PYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILR 561
           PYALRRA LG++RI+LE K+ +PL    +D +L+ FFHDRLK+YL D+  R+DLI+++L 
Sbjct: 541 PYALRRAALGVVRILLERKVRLPLLAVTKDADLLAFFHDRLKVYLRDQGARYDLIDSVLT 600

Query: 562 PENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLL 621
           PE D+LL +   ++ L  F +S  G+  L   KR  Q+LA EEKK   ++  +S   L L
Sbjct: 601 PEADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQLLAAEEKKGTAVADGVSESLLTL 660

Query: 622 EAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNR 681
           +AEK L+A ++        ++  + +      L ++  P++ FF  VLVN +D  +R NR
Sbjct: 661 DAEKDLFAAVTKASAEAANAIVGEDFRSAMAALSTLRAPVDRFFGDVLVNDEDAAIRANR 720

Query: 682 LSLLQYIKNIILIVINVQKI 701
           L+LL+ I+     V +  KI
Sbjct: 721 LALLRLIREATGTVADFSKI 740


>gi|325292025|ref|YP_004277889.1| glycyl-tRNA synthetase beta chain [Agrobacterium sp. H13-3]
 gi|325059878|gb|ADY63569.1| glycyl-tRNA synthetase beta chain [Agrobacterium sp. H13-3]
          Length = 717

 Score =  716 bits (1848), Expect = 0.0,   Method: Composition-based stats.
 Identities = 369/715 (51%), Positives = 494/715 (69%), Gaps = 14/715 (1%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVERGLTYEGAREYWTPRRLTLDIRGLN 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE+ GPR  A +KAI+GFLR  GL  +S+ Q+  DPKKGD Y+A++ KP R  
Sbjct: 61  ARSADVREEKKGPRTDANEKAIEGFLRGAGLNDVSEAQVVSDPKKGDFYIAIINKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISA------------FSWIRPLKSILCILVA 168
           E+++  ++P  I+  PWPKSMR      P  +              W+RPL+SI+C+   
Sbjct: 121 EEIIAEVMPGIIRSFPWPKSMRSGPASMPKGSSYAGIEGKGSESLRWVRPLQSIVCLFGP 180

Query: 169 EDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAI 228
           E  + ++I   +  I  GN+TYGHRFHAP PI V+  + Y+  LE+A V+LD + R++ I
Sbjct: 181 EHDETQVIPFVIDGIVAGNVTYGHRFHAPGPITVRRFEDYVSSLEKAKVILDADRRKDII 240

Query: 229 LNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQK 288
           L+DA  LA A GLELVED+ LLEE+ GLVEW QV MG+F++ YL +P E+IRLTIKTNQK
Sbjct: 241 LHDAKDLAFANGLELVEDEGLLEEVSGLVEWPQVLMGTFEEDYLQIPAEIIRLTIKTNQK 300

Query: 289 CFVTRTR--EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPN 346
           CFVTR +  E  L+N FIL+SNI+ASDGG  I+ GN +VV ARL DA HFW RDQ +LP+
Sbjct: 301 CFVTRNQGAEEGLSNRFILISNIEASDGGKEIIHGNGKVVRARLSDARHFWNRDQGDLPD 360

Query: 347 LSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDA 406
           L +LK+SA KF LDL KPLDQRMA+LD L+V FHAK+GTQGERV+RIR L K +A ++ A
Sbjct: 361 LETLKDSAAKFGLDLKKPLDQRMAKLDALNVTFHAKLGTQGERVARIRELAKALAAVVGA 420

Query: 407 DVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLE 466
           D ALVDRA+VL+KADL TE V EFPELQG +G++YA LQ EN S   AIE+H KP+GP +
Sbjct: 421 DAALVDRAVVLAKADLRTEAVGEFPELQGLMGRKYATLQGENESVAAAIEDHYKPQGPSD 480

Query: 467 NVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS 526
            +P +K++ITV+LADKLDTL+ FWAI+EKP+GSKDP+ALRRA LG++RI+LE  + +PL 
Sbjct: 481 RLPADKVAITVALADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVVRILLEKNVRLPLL 540

Query: 527 QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
              +D +L+ FFHDRLK+YL D   R+DLI+A+L PE+D+LL I   ++ L  F +   G
Sbjct: 541 SVAKDTDLLSFFHDRLKVYLRDLGARYDLIDAVLTPESDDLLMIARRVEALTAFITGEDG 600

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
              L  AKR  Q+LA EEKK   ++  +S + L L+AEK LYA I        ++++ + 
Sbjct: 601 RNLLAGAKRATQLLAAEEKKGTVVANSVSEELLKLDAEKALYAAIKTASADAAKAVETED 660

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +      L ++  P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 FRSAMQALSTLRAPVDKFFEDVLVNDEDAAIRANRLALLKAIREATGTVADFSKI 715


>gi|15887985|ref|NP_353666.1| glycyl-tRNA synthetase subunit beta [Agrobacterium tumefaciens str.
           C58]
 gi|229470693|sp|A9CK39|SYGB_AGRT5 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|15155593|gb|AAK86451.1| glycyl-tRNA synthetase, beta chain [Agrobacterium tumefaciens str.
           C58]
          Length = 717

 Score =  715 bits (1845), Expect = 0.0,   Method: Composition-based stats.
 Identities = 372/715 (52%), Positives = 496/715 (69%), Gaps = 14/715 (1%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVERGLTYEGAREYWTPRRLTLDIRGLN 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE+ GPR  A +KAI+GFLR  GL  IS+ Q+  DPKKGD Y+A++ KP R  
Sbjct: 61  ARSADVREEKKGPRTDANEKAIEGFLRGAGLNDISEAQVVSDPKKGDFYIAIINKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISA------------FSWIRPLKSILCILVA 168
           E+++  ++P  I+  PWPKSMR      P  +              W+RPL+SI+C+   
Sbjct: 121 EEIIAEVMPGIIRSFPWPKSMRSGPASMPKGSSYAGIEGKGSESLRWVRPLQSIVCLFGP 180

Query: 169 EDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAI 228
           E  + ++I   +  I  GNITYGHRFHAP PI V+  + Y+ +LE+A V+LD + R++ I
Sbjct: 181 EHDETQVIPFVIDGIVAGNITYGHRFHAPGPITVRRFEDYVSNLEKAKVILDADRRKDII 240

Query: 229 LNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQK 288
           L+DA  LA A GLELVED+ LLEE+ GLVEW QV MG+F++ YL +P E+IRLTIKTNQK
Sbjct: 241 LHDAKDLAFANGLELVEDEGLLEEVSGLVEWPQVLMGTFEEDYLQIPAEIIRLTIKTNQK 300

Query: 289 CFVTRTR--EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPN 346
           CFVTR +  E  L+N FIL+SNI+ASDGG  I+ GN +VV ARL DA HFW RDQ +LP+
Sbjct: 301 CFVTRNQGAEEGLSNRFILISNIEASDGGKEIIHGNGKVVRARLSDARHFWNRDQGDLPD 360

Query: 347 LSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDA 406
           L +LK+SA KF+LDL KPLDQRMA+LD L+V FHAK+GTQGERV+RIR L K +A ++ A
Sbjct: 361 LETLKDSAAKFDLDLKKPLDQRMAKLDALNVTFHAKLGTQGERVARIRELAKALAPVVGA 420

Query: 407 DVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLE 466
           D ALVDRA+VL+KADL TE V EFPELQG +G++YAVLQ EN S   AIE+H KP+GP +
Sbjct: 421 DGALVDRAVVLAKADLRTEAVGEFPELQGLMGRKYAVLQGENESVAAAIEDHYKPQGPSD 480

Query: 467 NVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS 526
            +P +K++ITV+LADKLDTL+ FWAI+EKP+GSKDP+ALRRA LG++RI+LE  + +PL 
Sbjct: 481 RLPADKVAITVALADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVVRILLEKNVRLPLL 540

Query: 527 QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
               D +L+ FFHDRLK+YL D   R+DLI+A+L PE+D+LL I   ++ L  F +   G
Sbjct: 541 SVARDSDLLSFFHDRLKVYLRDLGARYDLIDAVLTPESDDLLMIARRVEALTAFITGEDG 600

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
              L  AKR  Q+LA EEKK   ++  +S + L L+AEK LYA I        ++++ + 
Sbjct: 601 RNLLAGAKRATQLLAAEEKKGTVVADGVSEELLKLDAEKALYAAIKTASADAAKAVEGED 660

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +      L ++  P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 661 FRSAMQALSTLRAPVDKFFEDVLVNDEDAAIRANRLALLKAIREATGTVADFSKI 715


>gi|209548144|ref|YP_002280061.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533900|gb|ACI53835.1| glycyl-tRNA synthetase, beta subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 727

 Score =  714 bits (1843), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/725 (51%), Positives = 483/725 (66%), Gaps = 24/725 (3%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L + GL+
Sbjct: 1   MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR  GL ++S+ Q+  DPKKGD Y+AV+ KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPKKGDFYVAVISKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW    S   A  W+RPL+SI+C    E  +  +I  ++
Sbjct: 121 EEIVAEVMPGIIRDFPWPKSMRWGKASSRPGAMRWVRPLQSIVCTFGPEHEETVVIPFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   N TYGHRFHAP  I V+  D Y   LE+A V+LD E R++ IL+DA  +A A G
Sbjct: 181 DGITASNTTYGHRFHAPEAITVRRFDDYAASLEKAKVILDAERRKDIILHDARDIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LLEE+ GLVEW QV MGSF++ YL +P E+IRLTIKTNQKCFVTR + E  L
Sbjct: 241 LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRKQGEETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNIQA DGG  IV GN +VV ARL DALHFWKRDQ +LP+L +L  SA KF L
Sbjct: 301 SNKFILVSNIQAHDGGKEIVHGNGKVVRARLSDALHFWKRDQGDLPDLETLTASAAKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD LDV FHAK+GTQG RV+RIR L +++A++  AD AL DRA VL+K
Sbjct: 361 DLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAEELAKITGADAALTDRAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G++YA LQ EN S   AIE+H KP+GP + VP +K++ITV+L
Sbjct: 421 ADLRTEAVGEFPELQGLMGRKYAGLQGENGSVAAAIEDHYKPQGPSDRVPADKVAITVAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPL-------------- 525
           ADKLDTLI FWAI EKP+GSKDP+ALRRA LG++RI+LE  + +PL              
Sbjct: 481 ADKLDTLIGFWAIGEKPTGSKDPFALRRAALGVVRILLERNVRLPLLTIMSQTSLLAKTG 540

Query: 526 ---------SQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                           +L+ FFHDRLK+YL D+  RHDLI+A+L  + D+LL +   ++ 
Sbjct: 541 GDTVFAFAGDPAETFFDLLSFFHDRLKVYLRDQGARHDLIDAVLTSDADDLLMVARRVEA 600

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           L  F +S  G+  L   KR  Q+LA EEKK   I+  +SP  L L+AEK L+A IS    
Sbjct: 601 LTAFITSEDGKNLLAGTKRATQLLAAEEKKGTVIADAVSPALLKLDAEKELFAAISGASK 660

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
              +++  + +      L  +  P++ FF+ VLVN +D  +R NRL+LL+ I+     V 
Sbjct: 661 EAADAVASEDFRSAMAALSKLRGPVDRFFEDVLVNDEDAAIRANRLALLRLIREATGTVA 720

Query: 697 NVQKI 701
           +  KI
Sbjct: 721 DFSKI 725


>gi|110633071|ref|YP_673279.1| glycyl-tRNA synthetase subunit beta [Mesorhizobium sp. BNC1]
 gi|110284055|gb|ABG62114.1| glycyl-tRNA synthetase beta chain [Chelativorans sp. BNC1]
          Length = 789

 Score =  711 bits (1834), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/759 (45%), Positives = 473/759 (62%), Gaps = 58/759 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+   +YWTP RL L ++G++
Sbjct: 29  MPDLLLELRSEEIPARMQRKAAGDLKKLVTDGLVEAGLTYEAATEYWTPRRLALDIRGVT 88

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE  GP   A ++AI GFLR  GL  I+   +  DPKKG  Y+AV+ K  R  
Sbjct: 89  ARSRDVREEIKGPSTSAPEQAIQGFLRKAGLTDIAQAHVHTDPKKGGFYVAVIEKNGRPA 148

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMRW        +  W+RPL+SI+C    E  +  ++D ++
Sbjct: 149 EEIIAELMPAVIRNFPWPKSMRWGKASRNPGSLRWVRPLQSIVCTFGPETEEPVVVDFEI 208

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN+TYGHRFHAP  I V+  D Y+  LE+A V+LD E R+  IL+DA  LA A G
Sbjct: 209 DGIRAGNVTYGHRFHAPEAITVRRFDDYVEKLEQAKVVLDAERRKRIILDDAKNLAFANG 268

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTRE--GV 298
           LELVED+ LLEE+ GLVE+  V MG F++ YL +P E++RLTI+ NQKCFVTR +     
Sbjct: 269 LELVEDEGLLEEVSGLVEYPVVLMGEFEEAYLEIPAEVVRLTIRANQKCFVTRPQGELEK 328

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L+N FI+ +NI+A+DGG  I  GN +VV ARL DAL+FWK DQ +LP++  LK SA KF 
Sbjct: 329 LSNRFIITANIEATDGGKEIAYGNGKVVRARLSDALYFWKTDQADLPDIDRLKGSAEKFG 388

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
           LDL+KPLDQRMARL+ L+V FHAK+GTQGERV RIR L +++A ++ AD  L +RA VL+
Sbjct: 389 LDLNKPLDQRMARLEHLNVTFHAKLGTQGERVERIRRLARELAPIVGADPDLAERAAVLA 448

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           KADL TE+V EFPELQG +G++YA LQ E+ S   A+EEH KP GP + VPT+ +S+ V+
Sbjct: 449 KADLTTEVVGEFPELQGAMGRKYAELQGEHPSVARALEEHYKPLGPSDIVPTDPVSVAVA 508

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI--------- 529
           LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IRI++EN + + L +           
Sbjct: 509 LADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRIVVENGVRLALLKAFRKARNVSAE 568

Query: 530 EDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPE-------------------------- 563
             ++L+ FFHDRLK+YL D+  RHDLI+A+L                             
Sbjct: 569 NTEDLLSFFHDRLKVYLRDQGARHDLIDAVLASGRPISPLEGEMSPKATEGGAVPPTSQS 628

Query: 564 ---------------------NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAI 602
                                ND+LL IV  ++ L++   +  G+  L   KR   ILA 
Sbjct: 629 VTPPSALPGISPSRGEITPSSNDDLLLIVRRVEALSDLLGTETGQNLLAGTKRAANILAA 688

Query: 603 EEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIE 662
           EEKK   I+  + P  L  E E RL++ ++       E++  + +      L ++ EPI+
Sbjct: 689 EEKKGTRIAEAVDPALLKEEQEIRLFSAVNQAEKEAGEAIQKQDFSAAMTALAALREPID 748

Query: 663 IFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            FF++VLVN ++  +R NRL+LLQ I+     V +  KI
Sbjct: 749 SFFEKVLVNDENDSIRANRLALLQRIREATGRVADFSKI 787


>gi|114705267|ref|ZP_01438175.1| glycyl-tRNA synthetase beta subunit [Fulvimarina pelagi HTCC2506]
 gi|114540052|gb|EAU43172.1| glycyl-tRNA synthetase beta subunit [Fulvimarina pelagi HTCC2506]
          Length = 759

 Score =  701 bits (1808), Expect = 0.0,   Method: Composition-based stats.
 Identities = 347/757 (45%), Positives = 453/757 (59%), Gaps = 56/757 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++G+ 
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLTYEGAREYWTPRRLTLDVRGVD 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPR  A +KAI GFLR  GL +I + + + DPKKGD Y+AV+RKP R  
Sbjct: 61  ASSKNVNEERKGPRTDAPEKAIQGFLRGAGLSSIEEAETRSDPKKGDFYVAVIRKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E ++  ++P  I+  PWPKSMRW        +  W+RPL+SILC    E  +  ++D ++
Sbjct: 121 EQIIAEVMPGIIRNFPWPKSMRWGPASREPGSMRWVRPLQSILCTFGPETEEPVVVDFEV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T GHRFHAP    V+  D Y+  LE+A V+LD E R+  I  DA   A A+G
Sbjct: 181 SGIRSGNTTVGHRFHAPESFMVRRFDDYVDKLEKAHVILDAERRKEMIRTDAENRAFALG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT------ 294
           LE+V D+ LLEE+ GLVEW  V MGSFD+ +L +P E+I+LTIK NQKCFVTR       
Sbjct: 241 LEVVPDEGLLEEVSGLVEWPVVLMGSFDEAFLAIPPEVIQLTIKVNQKCFVTRPVGSEPQ 300

Query: 295 -------------------------REGVLANCFILVSNIQASDGGAAIVQGNSRVVAAR 329
                                        L+N F+L+SNI+ASDGG  I +GN +VV AR
Sbjct: 301 ARKAERPSPGQGAPAEPSAQQTGVSENNRLSNHFVLISNIEASDGGEEIARGNGKVVRAR 360

Query: 330 LEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGER 389
           L DAL+FWK DQ +LP+L SL+ SA KF LDL+KPLDQRMA+LD   V FHAK+GTQGER
Sbjct: 361 LSDALYFWKTDQADLPDLKSLEPSAEKFGLDLTKPLDQRMAKLDAQGVTFHAKLGTQGER 420

Query: 390 VSRIR------------------VLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFP 431
           V RI                   V   + A       + V RA VLSKADL TE V EFP
Sbjct: 421 VQRIAALAEAIAGEIAAQVTGNGVATSEDAFAAGELRSTVRRAAVLSKADLPTEAVGEFP 480

Query: 432 ELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWA 491
           ELQG +G+ YA LQ E+ S   AIEEH KP GP + VP + ++I V+LADKLD L+ FWA
Sbjct: 481 ELQGLMGRYYAKLQGEHPSVQAAIEEHYKPLGPGDQVPRDPVAICVALADKLDMLVGFWA 540

Query: 492 INEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDI 551
           I+EKP+GSKDPYALRRA LG+IRI+++N++ +    F    +L+ FFHDRL + L D   
Sbjct: 541 IDEKPTGSKDPYALRRAALGVIRILVDNRLVLKFGNFDVSSDLLAFFHDRLMVQLRDSGA 600

Query: 552 RHDLIEAILRP----ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKN 607
           RHDL++A+L       ND+LL I   ++ L +F  +  G+  L   +R   ILA EEKK 
Sbjct: 601 RHDLVDAVLSGSGEQSNDDLLDITRRVEALGQFLGAEDGQNLLAGYRRAANILAAEEKKG 660

Query: 608 REISLEISPQYLL---LEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIF 664
             I+  +   ++       EK L   I      + E+++ + Y Q    L  +  P++ F
Sbjct: 661 TTIAASVDADWIAAKGEHEEKVLAGAIDRAEIEVAEALETRDYGQAMAGLSKLRAPVDSF 720

Query: 665 FDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           FD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FDKVLVNAEDETVRANRLALLARIRAACEKVADFSKI 757


>gi|222147719|ref|YP_002548676.1| glycyl-tRNA synthetase subunit beta [Agrobacterium vitis S4]
 gi|221734707|gb|ACM35670.1| glycyl-tRNA synthetase beta chain [Agrobacterium vitis S4]
          Length = 764

 Score =  701 bits (1808), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/762 (48%), Positives = 481/762 (63%), Gaps = 61/762 (8%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L + G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVDAGLTYEGAREYWTPRRLVLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE+ GP V A +KAI+GFLR  GL +I    +K DPKKGD Y+A++ KP R  
Sbjct: 61  ARSADVKEEKKGPSVSAPEKAIEGFLRGAGLASIDQAVVKTDPKKGDFYVAMIDKPGRSA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISA------------FSWIRPLKSILCILVA 168
           E+++   +P  I+  PWPKSMR      P  +              W+RPL+SILC   +
Sbjct: 121 EEIITEAMPGIIRSFPWPKSMRSGAASMPKGSRYGGIEGKGSESLRWVRPLQSILCTFGS 180

Query: 169 EDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAI 228
           E  +  II  D+  I   NITYGHRFHAP  I V+  D Y+  LE+A V+LD E R++ I
Sbjct: 181 EHDEVAIIPFDIDGITASNITYGHRFHAPEAITVRRFDDYVSSLEKAKVILDAERRKDII 240

Query: 229 LNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQK 288
           L+DA  +A A GL+LVED+ LLEE+ GLVE+ QV +G+F+  YL +P E+IRLTIKTNQK
Sbjct: 241 LHDARDVAFANGLDLVEDEGLLEEVSGLVEYPQVLLGTFEADYLSIPSEIIRLTIKTNQK 300

Query: 289 CFVTRT--REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPN 346
           CFVTR       L+N FIL+SNI A DGGA I+ GN +VV ARL DALHFWKRDQ NLP+
Sbjct: 301 CFVTRPIGESEKLSNHFILISNIAAHDGGAEIIHGNGKVVRARLSDALHFWKRDQGNLPD 360

Query: 347 LSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDA 406
           L +L+ SA KF LDL KPLDQRMA+LD L+V FHAK+G+QGERV+RIR L K +A ++ A
Sbjct: 361 LETLEASAAKFGLDLKKPLDQRMAKLDALNVTFHAKLGSQGERVARIRDLAKVLAPVVGA 420

Query: 407 DVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLE 466
           D ALVDRA+VL+KADL TE V EFPELQG +G++YA LQ E+ S   AIE+H KP+GP +
Sbjct: 421 DEALVDRAVVLAKADLRTEAVGEFPELQGLMGRKYATLQGEHESVAAAIEDHYKPQGPSD 480

Query: 467 NVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS 526
            +P +K++ITV+LADKLDTL+ FWAINEKP+GSKDP+ALRRA LG +RI+LE  I + L 
Sbjct: 481 RLPEDKVAITVALADKLDTLVWFWAINEKPTGSKDPFALRRAALGDVRILLEKNIRLSLL 540

Query: 527 QFIEDQ-----------------------------------------------NLILFFH 539
                                                                +L+ FFH
Sbjct: 541 DVFAHSLLGRSLTSEEIERIIDAAIYESVAGGAPKDSTSSKYSQEFASVFLGGSLLSFFH 600

Query: 540 DRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQI 599
           DRLK+YL D+  RHD+I+A+L PE D+LL +    + L  F +S  G+  L   KR  Q+
Sbjct: 601 DRLKVYLRDQGARHDIIDAVLTPEADDLLMVARRAEALTAFITSEDGKNLLAGTKRATQL 660

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK   ++  +S   L L+AEK LYA I        E++  + +      L ++  
Sbjct: 661 LAAEEKKGTVVADGVSEALLTLDAEKALYAAIVQATQSAAEAVAKEDFRSAMQALSTLRA 720

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF+ VLVN +D  +R NRL+LL+ I+     V +  KI
Sbjct: 721 PVDTFFEDVLVNDEDAAIRANRLALLKAIREATGTVADFSKI 762


>gi|150395691|ref|YP_001326158.1| glycyl-tRNA synthetase subunit beta [Sinorhizobium medicae WSM419]
 gi|229558576|sp|A6U6P3|SYGB_SINMW RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|150027206|gb|ABR59323.1| glycyl-tRNA synthetase, beta subunit [Sinorhizobium medicae WSM419]
          Length = 721

 Score =  700 bits (1806), Expect = 0.0,   Method: Composition-based stats.
 Identities = 360/719 (50%), Positives = 480/719 (66%), Gaps = 18/719 (2%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLIELRSEEIPARMQRKAAGDLKKLVTDALVEAGLTYEGAREYWTPRRLTLDIRGLN 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR+ A  KAI+GFLR+ GL +IS+  +  DPKKGD Y+A + +  R  
Sbjct: 61  ARSADMREERKGPRIDANDKAIEGFLRAAGLSSISEAHVHNDPKKGDFYVAHIVRRGREA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMR     +   +  W+RPL+SI+C   AE  + K+I  ++
Sbjct: 121 EEIVADVMPAIIRDFPWPKSMRSGAASAIPGSLRWVRPLQSIVCTFGAEHDETKVIPFEV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+    Y   L +A V++D E R+  I  DAH +A A G
Sbjct: 181 DGIVASNITYGHRFHAPEAIAVRRFADYAEKLGKAKVVIDAERRKEIISADAHNIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-L 299
           LELVED+ LLEE+ GLVEW +V MGSF++ YL +P E+IRLTIKTNQKCFVTR      L
Sbjct: 241 LELVEDEGLLEEVAGLVEWPKVLMGSFEESYLAIPSEIIRLTIKTNQKCFVTRKPGAETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNI+A DGG  IV GN +VV ARL DA HFWKRDQ +LP+L +L  SA KF L
Sbjct: 301 SNRFILVSNIEAKDGGKEIVHGNGKVVRARLSDAAHFWKRDQGDLPDLETLAASAGKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD L+V FHAK+GTQGERV+RIR L   +A++  AD A V RA VL+K
Sbjct: 361 DLKKPLDQRMAKLDALNVTFHAKLGTQGERVARIRSLAAALAKITGADPASVARAAVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G +YAVLQ E+ +  +AIE+H KP+GP ++VPT+ +S++V+L
Sbjct: 421 ADLRTEAVGEFPELQGIMGHKYAVLQGESAAVANAIEDHYKPQGPSDHVPTDPVSVSVAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           ADKLDTL+ FWAI+E+P+GSKDPYALRRA LG+IR+ILE +  +PL    +         
Sbjct: 481 ADKLDTLVGFWAIDERPTGSKDPYALRRAALGVIRLILEGRARLPLLPCFDVALASLKLQ 540

Query: 531 --------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFS 582
                     +L+ FFHDRLK+YL D   RHDLI+A+L P+ D+LL I   ++ L  F +
Sbjct: 541 RPAMAADVSGDLLAFFHDRLKVYLRDLGARHDLIDAVLAPDADDLLMIARRVEALTAFIT 600

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESM 642
           + +G   L   KR  QILA EEKK  E++  +  +   L+AE+ LYA I       + ++
Sbjct: 601 AEEGRNLLAGTKRATQILAAEEKKGTEVAASVDEELFRLDAERLLYASIKVASDGARAAI 660

Query: 643 DHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + +    + L  + EP++ FF+ VLVN +D+ +R NRL+LL  I++    V +  KI
Sbjct: 661 AKEDFRSAMEALSKLREPVDAFFNDVLVNDEDKAIRANRLALLGLIRSATGEVADFSKI 719


>gi|15964608|ref|NP_384961.1| glycyl-tRNA synthetase subunit beta [Sinorhizobium meliloti 1021]
 gi|307309354|ref|ZP_07589017.1| glycyl-tRNA synthetase, beta subunit [Sinorhizobium meliloti
           BL225C]
 gi|307320090|ref|ZP_07599511.1| glycyl-tRNA synthetase, beta subunit [Sinorhizobium meliloti AK83]
 gi|81854356|sp|Q92RL2|SYGB_RHIME RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|15073786|emb|CAC45427.1| Probable glycyl-tRNA synthetase beta chain [Sinorhizobium meliloti
           1021]
 gi|306894305|gb|EFN25070.1| glycyl-tRNA synthetase, beta subunit [Sinorhizobium meliloti AK83]
 gi|306900223|gb|EFN30841.1| glycyl-tRNA synthetase, beta subunit [Sinorhizobium meliloti
           BL225C]
          Length = 721

 Score =  699 bits (1803), Expect = 0.0,   Method: Composition-based stats.
 Identities = 363/719 (50%), Positives = 479/719 (66%), Gaps = 18/719 (2%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLIELRSEEIPARMQRKAAGDLKKLVTDALVEAGLTYEGAREYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR+ A +KAI+GFLR+ GL ++S+  +  DPKKGD Y+A + KP R  
Sbjct: 61  ARSADLREERKGPRIDANEKAIEGFLRAAGLSSLSEAHVHNDPKKGDFYVAHIVKPGREA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  I+  PWPKSMR     +   +  W+RPL+SI+C   AE  + K+I  ++
Sbjct: 121 EEIIADVMPAIIRDFPWPKSMRSGAASAKPGSLRWVRPLQSIVCTFGAEHDETKVIPFEV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+    Y   LE+A V++D E R+  I  DAH +A A G
Sbjct: 181 DGIVASNITYGHRFHAPEAITVRRFADYAEKLEKAKVVIDAERRKEIISADAHNVAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-L 299
           LELVED+ LLEE+ GLVEW +V MGSF++ YL +P E+IRLTIKTNQKCFVTR      L
Sbjct: 241 LELVEDEGLLEEVAGLVEWPRVLMGSFEESYLEIPSEIIRLTIKTNQKCFVTRKPGAETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNI+A DGG  I  GN +VV ARL DA HFWKRDQ++LP+L +L  SA KF L
Sbjct: 301 SNRFILVSNIEAKDGGKEIAHGNGKVVRARLSDAAHFWKRDQSDLPDLETLTASAEKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD L+V FHAK+GTQGERV+RIR L   +A+L  AD A VDRA+VL+K
Sbjct: 361 DLKKPLDQRMAKLDALNVTFHAKLGTQGERVARIRSLAAALARLTGADAASVDRAVVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G +YAVLQ E  +  DAIE+H KP+GP + VPT+ +S TV+L
Sbjct: 421 ADLRTEAVGEFPELQGIMGHKYAVLQGEAAAVADAIEDHYKPQGPSDRVPTDPVSATVAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR+ILE    +PL    +         
Sbjct: 481 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLILEGSARLPLLPCFDVALAALKAQ 540

Query: 531 --------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFS 582
                     +L+ FFHDRLK+YL D   R+DLI+A+L P+ D+LL I   ++ L  F +
Sbjct: 541 RPDIRAEISADLLAFFHDRLKVYLRDLGARYDLIDAVLAPDADDLLMIARRVEALTAFIT 600

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESM 642
           + +G   L   KR  QILA EEKK  E++  +      L+AE+ L+A I       ++++
Sbjct: 601 AEEGRNLLTGTKRATQILAAEEKKGTEVAESVDEALFRLDAERTLHASIKVASDDARDAI 660

Query: 643 DHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + +      L  +  P++ FF+ VLVN +D+ +R NRL+LL  I++    V +  KI
Sbjct: 661 VKEDFRSAMQALSKLRAPVDDFFNDVLVNDEDKAIRANRLALLGLIRSATGEVADFSKI 719


>gi|298293954|ref|YP_003695893.1| glycyl-tRNA synthetase subunit beta [Starkeya novella DSM 506]
 gi|296930465|gb|ADH91274.1| glycyl-tRNA synthetase, beta subunit [Starkeya novella DSM 506]
          Length = 687

 Score =  698 bits (1801), Expect = 0.0,   Method: Composition-based stats.
 Identities = 311/704 (44%), Positives = 443/704 (62%), Gaps = 22/704 (3%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ  AAE+L  ++   L E G++Y+  + + TP RL L + GL 
Sbjct: 1   MPDLLLELFSEEIPARMQAGAAENLRKLVTDALVERGLLYEGAKAFVTPRRLALAIHGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
            H P+  EER GPRVGA + AI GFL++ GL ++ + +I  DPKKGD Y+A + +  R  
Sbjct: 61  AHQPDTHEERKGPRVGAPEAAIQGFLKAAGLSSLDEAKIVSDPKKGDSYVAHIHRHGRPT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DV+  IVP  ++  PWPKSMRW    +   +  W+RPL+SILC    E  + +++  ++
Sbjct: 121 PDVVAEIVPEIVRGFPWPKSMRWGKASAETGSLRWVRPLQSILCTFGPETEEPEVVRFEI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  G+ T GHRF +   I+V+ LD ++  LE A V+ D + R++ ILNDA  LA A G
Sbjct: 181 DGLESGDTTRGHRFLSEGAIRVRRLDDWMAKLEAAFVVADRDRRKDIILNDAKDLALAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LL+EI GLVEW  V MG+F++ +L +P+E+IR TI+ NQKCFV +    G L
Sbjct: 241 LELVEDEGLLDEIAGLVEWPVVLMGAFEEGFLDVPDEVIRATIRINQKCFVLKDPATGRL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN FILVSN++ASDGG AIV GN RV+ ARL DA  FW+ D+                  
Sbjct: 301 ANRFILVSNLKASDGGKAIVAGNERVIRARLSDAKFFWETDKKTNA-------------- 346

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
             + PL++R+A+    +V FH K+G+Q ER+ RI  L K +A L+ AD  L +RA + +K
Sbjct: 347 --AVPLEERLAK--FGNVTFHEKLGSQLERIQRIAALAKALAPLVGADPELAERAALYAK 402

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           +DL TE+V EFPE+QG +GK YA L+        A EEH KP+GP + VPT  +S+ V+L
Sbjct: 403 SDLRTEVVGEFPEVQGLMGKYYARLEGLPEEIALAAEEHYKPQGPTDRVPTAPVSVAVAL 462

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFH 539
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG++R++LEN + + L++F+E  +L+ FF 
Sbjct: 463 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVVRLVLENGLRLKLTEFVE-PDLLAFFA 521

Query: 540 DRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQ 598
           DRLK++L ++  RHDL++A+   P+ D+LL IV  ++ L  F SS  G   L   KR   
Sbjct: 522 DRLKVHLREQGARHDLVDAVFALPDQDDLLLIVKRVEALGRFLSSEDGRNLLAGTKRAAN 581

Query: 599 ILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSI 657
           IL IEEKK+       +         E+ L   I+D    I+ ++  + +     L+  +
Sbjct: 582 ILRIEEKKDGIAYEGGVDTALFAEPEERALADAIADLRPQIEAALASEDFEGAMALIARL 641

Query: 658 CEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             P++ FFD+V VN +D+ +R NRL LL  I+     + +  +I
Sbjct: 642 RAPVDAFFDKVTVNAEDKALRANRLRLLADIRTATRAIADFDRI 685


>gi|90420145|ref|ZP_01228053.1| glycyl-tRNA synthetase, beta chain [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335479|gb|EAS49229.1| glycyl-tRNA synthetase, beta chain [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 724

 Score =  697 bits (1799), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/722 (46%), Positives = 459/722 (63%), Gaps = 21/722 (2%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++G+ 
Sbjct: 1   MPDLLLELRSEEIPARMQRKAAGDLRKLVTDALVEAGLTYEGCREYWTPRRLTLDVRGVD 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S + ++ER GPR  A +KAI GFLR  GL +I +  I+ DPKKGD Y+A +RKP R  
Sbjct: 61  ARSRDVVDERKGPRTDAPEKAIQGFLRGAGLASIDEATIQSDPKKGDFYVATIRKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++P  ++  PWPKSMRW        +  W+RPL+SILC    E  +  ++D ++
Sbjct: 121 EEIIAEVMPGIVRGFPWPKSMRWGPASREPGSLRWVRPLQSILCTFGPETEEPVVVDFEV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN+T GHRFHA    +V+  D Y+  LE+A V+LD E R++ I +DA  LA A G
Sbjct: 181 DGIRAGNVTRGHRFHAAEEFRVRRFDDYVAGLEKAFVVLDAERRKDMIRHDAENLAFARG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EGV 298
           LE+V D+ LLEE+ GLVEW    MG F++ +L +P E+I+LTIK NQKCFVTR +  +G 
Sbjct: 241 LEVVPDEALLEEVSGLVEWPVTLMGEFEETFLQIPPEVIQLTIKVNQKCFVTRRQGGDGT 300

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L+N F+LVSNI ASDGGA I +GN +VV ARL DAL+FW+ DQ +LP   +L  +A KF 
Sbjct: 301 LSNQFVLVSNIAASDGGAEIARGNGKVVRARLSDALYFWQTDQADLPGRDALAPAAEKFR 360

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDAD----------- 407
           LDL+KPLDQRMA+LD L V FHA++GTQGERV RI  L ++IA  +  D           
Sbjct: 361 LDLAKPLDQRMAKLDALGVTFHARLGTQGERVGRIAALAREIAATVYPDGATLGGASVSA 420

Query: 408 ---VALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
                LV RA VL+KADL TE V EFPELQG +G+ YA LQ E+ S   A+EEH KP GP
Sbjct: 421 DELKPLVTRAAVLAKADLTTEAVGEFPELQGLMGRYYAALQGEHPSVQAALEEHYKPLGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            ++VPT+ ++I V+LADKLD L+ FWAI+EKP+GSKDPYALRRA LG+IR++L+N++ + 
Sbjct: 481 TDSVPTDPVAICVALADKLDMLVGFWAIDEKPTGSKDPYALRRAALGVIRLVLDNELVMA 540

Query: 525 LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAIL-----RPENDNLLTIVDLIKHLNE 579
           L  F+   +L+ FFHDRLK+ L +   RHDL++A+L         D+LL +   +  L  
Sbjct: 541 LGGFMPASDLLAFFHDRLKVQLRESGARHDLVDAVLSGGSGGDRGDDLLDVTRRVTALGA 600

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F  +  G+  L   +R   ILA EEKK   ++  +S   L    EK L   I      + 
Sbjct: 601 FLDTEDGQNLLAGTRRAANILAAEEKKGTRVADAVSLDLLSEHEEKVLAGAIDRAEIELD 660

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            ++  + Y      L  +  P++ FF+ VLVN +D  VR NRL+LL  I+     V +  
Sbjct: 661 AALAVENYAHAMTALAELRIPVDAFFETVLVNAEDEAVRANRLALLDRIRAATRRVADFS 720

Query: 700 KI 701
           +I
Sbjct: 721 RI 722


>gi|227821046|ref|YP_002825016.1| glycyl-tRNA synthetase subunit beta [Sinorhizobium fredii NGR234]
 gi|254781859|sp|C3MHD5|SYGB_RHISN RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|227340045|gb|ACP24263.1| glycyl-tRNA synthetase beta chain [Sinorhizobium fredii NGR234]
          Length = 721

 Score =  695 bits (1794), Expect = 0.0,   Method: Composition-based stats.
 Identities = 365/719 (50%), Positives = 482/719 (67%), Gaps = 18/719 (2%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E+ SEEIPARMQ KAA DL  ++   L E G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLIELRSEEIPARMQRKAAGDLKKLVTDALVEAGLTYEGAREYWTPRRLTLDIRGLN 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KAI+GFLR+ GL +I D  +  DPKKGD Y+A + KP R  
Sbjct: 61  ARSADVREERKGPRTDANEKAIEGFLRAAGLSSIGDAHVHSDPKKGDFYVAHIVKPGRDA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  ++P  I+  PWPKSMR     +   +  W+RPL+SI+C   AE  + ++I   +
Sbjct: 121 EDIVAEVMPAIIRDFPWPKSMRSGAASAKPGSLRWVRPLQSIVCTFGAETEETRVIPFAV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRFHAP  I V+    Y   LE+A V+LD E R+  I  DA  +A A G
Sbjct: 181 DGITASNITYGHRFHAPEAIMVRRFADYADKLEKAKVVLDAERRKEIIGADARNIAFANG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV-L 299
           LELVED+ LLEE+ GLVEW +V MGSF++ YL +P E+IRLTIKTNQKCFVTR      L
Sbjct: 241 LELVEDEGLLEEVTGLVEWPRVLMGSFEESYLEIPSEIIRLTIKTNQKCFVTRQPGAETL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           +N FILVSNI+A DGG  IV GN +VV ARL DA HFWKRDQ +LP+L +LK SA KF L
Sbjct: 301 SNRFILVSNIEAKDGGKEIVHGNGKVVRARLSDAAHFWKRDQGDLPDLETLKPSAEKFGL 360

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
           DL KPLDQRMA+LD L+V FHAK+GTQGERV+RIR +   +A++  AD ALV+R++VL+K
Sbjct: 361 DLGKPLDQRMAKLDALNVTFHAKLGTQGERVARIRSIALALAEVTGADQALVERSVVLAK 420

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE V EFPELQG +G +YAVLQ E+ +  +AIE+H KP+GP + VPT+ +S  V+L
Sbjct: 421 ADLRTEAVGEFPELQGIMGHKYAVLQGEDAAVANAIEDHYKPQGPSDRVPTDAVSAAVAL 480

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           ADKLDTL  FWAI+EKP+GSKDPYALRRA LG+IR+ILE +  +PL  F +         
Sbjct: 481 ADKLDTLAGFWAIDEKPTGSKDPYALRRAALGVIRLILEGRTRLPLLPFFDVALKALRTQ 540

Query: 531 --------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFS 582
                     +L+ FFHDRLK+YL D   R+DLI+A+L  E D+LL I   ++ L  F +
Sbjct: 541 RPDLTGDIAADLLAFFHDRLKVYLRDLGARYDLIDAVLTSEADDLLMIARRVEALTAFIT 600

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESM 642
           + +G+  L   KR  QILA EEKK  E++ ++  +   L+AE+ L+A I       +E++
Sbjct: 601 AEEGKNLLAGTKRATQILAAEEKKGTEVADQVDERLFRLDAERTLHASIKLASDDAREAI 660

Query: 643 DHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + +      L  + EP+++FF+ VLVN +DR +R NRL+LL  I++    V +  KI
Sbjct: 661 GKEDFRSAMAALSKLREPVDVFFNDVLVNDEDRAIRANRLALLGLIRSATGEVADFSKI 719


>gi|299134688|ref|ZP_07027880.1| glycyl-tRNA synthetase, beta subunit [Afipia sp. 1NLS2]
 gi|298590498|gb|EFI50701.1| glycyl-tRNA synthetase, beta subunit [Afipia sp. 1NLS2]
          Length = 691

 Score =  692 bits (1786), Expect = 0.0,   Method: Composition-based stats.
 Identities = 314/711 (44%), Positives = 435/711 (61%), Gaps = 32/711 (4%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L E++SEEIPARMQ KAA+DL  ++   L  EG++Y+  + + TP RL L + GL 
Sbjct: 1   MPDLLFELFSEEIPARMQAKAADDLRRMVTDKLVAEGLVYEGAKAFATPRRLALTVHGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  EER GP+VGA   A+ GFL++TGL+++ + +I+KDPKKGD Y+A++ KP R  
Sbjct: 61  GRQPDLKEERKGPKVGAPDAAVQGFLKATGLKSLDEAKIQKDPKKGDFYIALIEKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DV+  I+PV ++  PWPK MRW    +   A +W+RPL SI+     E     ++  D+
Sbjct: 121 IDVIAEILPVIVRTFPWPKQMRWGAGSATRGALTWVRPLHSIIATFGLETEDPDVVKFDV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G +T GHRF AP    V+  + Y+  LE A V+LDP+ RR+ IL DA +LA A G
Sbjct: 181 GGIEAGQVTRGHRFMAPAEFSVRRFEDYVAKLEAAKVVLDPQRRRDIILADAKQLAFAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
            ELVED+ LLEE+ GLVEW    MGSFD+ +L +P E+IR TI+ NQKCFV R  + G L
Sbjct: 241 YELVEDEALLEEVAGLVEWPVALMGSFDQDFLSIPGEVIRATIRNNQKCFVVRDPKTGKL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           A  FILVSNI+A+DGG AIV GN RV+ ARL DA  F++ D                   
Sbjct: 301 APKFILVSNIEATDGGKAIVAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + +  ++VFH K+GTQ ER++RI  L  +IA L+ ADV    RA  L+K
Sbjct: 342 -LKTKLEARLPKFE--NIVFHEKLGTQAERIARIERLAAEIAPLVGADVEKTKRAARLAK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPE+QG +GK YA+ Q E+ S   AIE+H KP+GP + VP + ++I V+L
Sbjct: 399 ADLLTEVVGEFPEVQGLMGKYYALAQGEDASVAAAIEDHYKPQGPNDRVPNDPVAIAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-------EDQ 532
           ADK+D L  FWAI+EKP+GSKDP+ALRRA LG IR+I +N I +PL           + +
Sbjct: 459 ADKIDILTGFWAIDEKPTGSKDPFALRRAALGAIRLIADNGIRLPLLATFAKAAKPHDGK 518

Query: 533 NLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLL 591
           +L+ FF DRLK+ L ++  RHDL++A+      D+LL +V  ++ L +F  +  G+  L 
Sbjct: 519 DLLSFFADRLKVQLREQGARHDLVDAVFALGGQDDLLMVVRRVEALGKFLDTDDGKNLLA 578

Query: 592 SAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQI 650
             KR   ILAIEEKK++   +         L+ EK L A I         ++  + +   
Sbjct: 579 GTKRASNILAIEEKKDKRNFTGAPEASLYKLDEEKNLAAAIEQVKAEAGTAVAKEDFAGA 638

Query: 651 GDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
              L  +   ++ FFD+V VN DD+ VR+NRL LL  I+     V +  KI
Sbjct: 639 MGALAKLRPVVDAFFDKVKVNDDDKAVRENRLKLLNEIREATRAVADFSKI 689


>gi|148253849|ref|YP_001238434.1| glycyl-tRNA synthetase subunit beta [Bradyrhizobium sp. BTAi1]
 gi|229470695|sp|A5EED4|SYGB_BRASB RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|146406022|gb|ABQ34528.1| glycyl-tRNA synthetase beta chain [Bradyrhizobium sp. BTAi1]
          Length = 701

 Score =  684 bits (1766), Expect = 0.0,   Method: Composition-based stats.
 Identities = 311/721 (43%), Positives = 431/721 (59%), Gaps = 42/721 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAAEDL  ++   L  EG++Y+  + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAAEDLRRMVTDKLVAEGLVYEGAKAFATPRRLALTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVG    AI GFL++TGL ++ +  I++DPKKGD Y+A++ KP R  
Sbjct: 61  ARQADLKEERKGPRVGGPDAAIQGFLKATGLSSLEEATIQRDPKKGDFYVALIEKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  ++PV ++  PWPKSMRW        A +W+RPL +I      E  +  ++   +
Sbjct: 121 LDVLAEMLPVIVRTFPWPKSMRWGKRSEKPGALNWVRPLHAITATFGLETEEPDVVSFSV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF AP  I V+  + Y   L +A V+LDP+ R++ I+ DA +LA A G
Sbjct: 181 DGIEAGQTTYGHRFMAPAAISVRRFEDYEAKLLDAKVVLDPQRRKDTIVTDAKQLAFAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
            ELVED  LL+E+ GLVEW  V MGSFD +YL +P E+IR TI+ NQKCFV R  + G L
Sbjct: 241 YELVEDPVLLDEVSGLVEWPVVLMGSFDPEYLKVPAEVIRATIRNNQKCFVVRDPKTGGL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           A  FIL +NI+A+DGG  I+ GN RV+ ARL DA  F++ D                   
Sbjct: 301 APKFILTANIEATDGGKTIIAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + +   +VFH K+GTQ  R++RI  L  +IA L+ AD A   RA  L+K
Sbjct: 342 -LKTRLEDRLPKFEQ--IVFHEKLGTQAARIARIEKLAAEIAPLVGADAAKTARAAKLAK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPE+QG +GK YA+ Q E++S   A EEH KP+GP + VPT+ +S+ V+L
Sbjct: 399 ADLLTEVVGEFPEVQGLMGKYYALAQGEDVSVAAACEEHYKPQGPGDRVPTDPVSVAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF----------- 528
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR+I EN + + L Q            
Sbjct: 459 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLITENSLRLSLLQVAGSALAGLHVK 518

Query: 529 ------IEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFF 581
                     +L+ FF DRLK+ L ++  RHDL++A+      D+LL +V  ++ L +F 
Sbjct: 519 SELDAGKLSADLLSFFADRLKVQLREQGARHDLVDAVFALGGQDDLLMVVRRVEALGKFL 578

Query: 582 SSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            +  G+  L   KR   ILAIEEKK++ +           L+ EK L   I + G+    
Sbjct: 579 ETDDGKNLLAGTKRASNILAIEEKKDKRKFDGAPDAALYRLDEEKALAKAIGEVGSEAGT 638

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
           ++  + +      +  +   ++ FFD+V VN DD  +R+NRL LL  I+N    V +  K
Sbjct: 639 AVAKEDFAAAMHAMAKLRPAVDAFFDKVKVNDDDAAIRENRLKLLNEIRNATRAVADFSK 698

Query: 701 I 701
           I
Sbjct: 699 I 699


>gi|90425820|ref|YP_534190.1| glycyl-tRNA synthetase subunit beta [Rhodopseudomonas palustris
           BisB18]
 gi|90107834|gb|ABD89871.1| Glycine--tRNA ligase [Rhodopseudomonas palustris BisB18]
          Length = 728

 Score =  683 bits (1763), Expect = 0.0,   Method: Composition-based stats.
 Identities = 314/748 (41%), Positives = 420/748 (56%), Gaps = 69/748 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAAEDL  ++   L  EG++Y   + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAAEDLRRMVTDKLVAEGLVYDGAKAFATPRRLALTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVG    AI GFL++TGL ++ + +I++DPKKGD Y+A++ KP R  
Sbjct: 61  ARQSDLKEERKGPRVGGPDAAIQGFLKATGLASLDEAKIQRDPKKGDFYIALIEKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  I+PV ++  PWPKSMRW    +   A  W+RPL SI+     +     ++  D+
Sbjct: 121 LDVLADILPVIVRTFPWPKSMRWGERSAKPGALQWVRPLHSIVATFGIDTEDPDVVAFDV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G +T GHRF AP  I V+  + Y   L +A V+LDP+ R++ IL+DA  LA A  
Sbjct: 181 SGIKAGQVTRGHRFMAPGEISVRRFEDYDAKLFDAKVVLDPQRRKDIILHDARTLAQAQN 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
            ELVED  LL+E+ GLVEW    MGSFD  +L +P E+IR TI+ NQKCFV      G L
Sbjct: 241 FELVEDPVLLDEVSGLVEWPVALMGSFDPAFLAIPGEVIRATIRNNQKCFVVSDPATGKL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
            N FIL +NI+ASDGG AIV GN RV+ ARL DA  F++ D                   
Sbjct: 301 TNKFILTANIEASDGGKAIVAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ +     +VFH K+GTQ ER++RI  L  +IA L+ ADV    RA  L K
Sbjct: 342 -LKTKLEDRLPK--FAQIVFHEKLGTQAERIARIERLAAEIAPLVGADVEKARRAAQLCK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPELQG +GK YA+ Q E+ S   A EEH KP+GP + VP++ +SI V+L
Sbjct: 399 ADLLTEVVGEFPELQGLMGKYYALAQGEDASVAAACEEHYKPQGPNDRVPSDPVSIAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ------- 532
           ADK+DTL+ FWAI+EKP+GSKDPYALRRA LG+IR+ILEN I   L    E         
Sbjct: 459 ADKIDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLILENNIRPNLISAFEGHSSAVDQT 518

Query: 533 -------------------------------------NLILFFHDRLKLYLHDRDIRHDL 555
                                                +L+ FF DRLK+ L ++  RHDL
Sbjct: 519 TMRIAQTKAKSSGGFSLVLNAHSTQSWNDRQTRTTSVDLLSFFADRLKVQLREQGARHDL 578

Query: 556 IEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKN-REISLE 613
           ++A+      D++L IV  ++ L  F ++  G+  L   KR   IL IEEKK+ R     
Sbjct: 579 VDAVFALEGQDDILMIVRRVEALAAFLATDDGKNLLAGVKRAANILRIEEKKDARAFDGA 638

Query: 614 ISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVD 673
                 + + EK L   I         ++  + +      +  +   ++ FFD+V VN D
Sbjct: 639 PDASLYVADEEKTLATAIDQVKLEASSAVAREDFAAAMSAMAKLRPAVDAFFDKVKVNDD 698

Query: 674 DREVRDNRLSLLQYIKNIILIVINVQKI 701
           D  VRDNRL LL  I+     V +  KI
Sbjct: 699 DARVRDNRLKLLNEIRAATRAVADFSKI 726


>gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040771|gb|ACT57567.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 702

 Score =  683 bits (1762), Expect = 0.0,   Method: Composition-based stats.
 Identities = 702/702 (100%), Positives = 702/702 (100%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS
Sbjct: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
           PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI
Sbjct: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL
Sbjct: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
           KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG
Sbjct: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA
Sbjct: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD
Sbjct: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA
Sbjct: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA
Sbjct: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHD 540
           DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHD
Sbjct: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHD 540

Query: 541 RLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQIL 600
           RLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQIL
Sbjct: 541 RLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQIL 600

Query: 601 AIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEP 660
           AIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEP
Sbjct: 601 AIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEP 660

Query: 661 IEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV 702
           IEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
Sbjct: 661 IEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV 702


>gi|220924241|ref|YP_002499543.1| glycyl-tRNA synthetase subunit beta [Methylobacterium nodulans ORS
           2060]
 gi|254781857|sp|B8IBI6|SYGB_METNO RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|219948848|gb|ACL59240.1| glycyl-tRNA synthetase, beta subunit [Methylobacterium nodulans ORS
           2060]
          Length = 701

 Score =  680 bits (1755), Expect = 0.0,   Method: Composition-based stats.
 Identities = 321/721 (44%), Positives = 427/721 (59%), Gaps = 42/721 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ +AAEDL  ++   L E G +Y+  + + TP RL L++ GL 
Sbjct: 1   MPDLLLELFSEEIPARMQRRAAEDLRKLVTDALVERGFLYEGAKAFATPRRLALHIAGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVGA + AI GFL+S GL +++D  +  DPKKG+ Y+AV+ +P R  
Sbjct: 61  TRGKDVREERKGPRVGAPEAAIQGFLKSAGLTSLADATVVADPKKGEFYVAVIERPGRDT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  I+P  I+  PWPKSMRW    +   +  W+RPL SI+     E    + +   +
Sbjct: 121 IDVLAEILPAVIRNFPWPKSMRWGAASTEPGSLRWVRPLHSIVASFGPETETPERVPFAI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF AP PI+V+    Y+  LE A V+LD + RR+ IL+DA  LA A G
Sbjct: 181 DGIEAGFTTYGHRFLAPGPIEVRRFADYLPALERARVVLDADRRRDIILHDARDLAFARG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTRE---- 296
           L+LVED+ LLEE+ GLVEW    MGSFD+ +L +P E+IR TI+ NQKCFV R       
Sbjct: 241 LDLVEDEGLLEEVAGLVEWPVTLMGSFDESFLDIPPEVIRATIRANQKCFVLRAPSQDGR 300

Query: 297 GVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALK 356
             LAN FILVSN+ ASDGGAAIV GN RVV ARL DA  FW+ D+               
Sbjct: 301 ERLANAFILVSNLAASDGGAAIVAGNERVVRARLSDAKFFWETDK--------------- 345

Query: 357 FNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIV 416
                  PL+ R+ +L   D+VFH K+GTQG RV RI  L + +A L+ AD  L  RA  
Sbjct: 346 -----KVPLESRLPKLK--DIVFHEKLGTQGARVERIAALARNLAPLVGADAGLAGRAAR 398

Query: 417 LSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISIT 476
           L+KADL TE+V EFPELQG +G+ YA LQ E  +   AIEEH KP GP + VPT  +S+ 
Sbjct: 399 LAKADLVTEMVGEFPELQGLMGRYYAELQGEPAAIATAIEEHYKPLGPSDRVPTEPVSVA 458

Query: 477 VSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED----- 531
           V+LADKLDTL+ FWAI+EKP+GSKDP+ALRRA LG+IR++L   + +PL           
Sbjct: 459 VALADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVIRLVLAGDVRLPLLGAFAQAVAGH 518

Query: 532 ---------QNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFF 581
                     +L+ FF DRLK++L D+  RHDLI+A+   P  D+LL IV  ++ L  F 
Sbjct: 519 AAVGPESFAADLLGFFADRLKVHLRDQGARHDLIDAVFAIPGQDDLLMIVRRVEALGRFL 578

Query: 582 SSAKGEKFLLSAKRIFQILAIEEKKN-REISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            +  G   L   +R   IL IEEK++ R       P    L  E  L   +        E
Sbjct: 579 DTEDGRNLLAGFRRAANILRIEEKRDGRAYDAAPDPALFSLPEESALANALDAARARAAE 638

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
           ++  + +      L ++  P++ FFD+V VN +D  +R NRL+LL  ++     V +  +
Sbjct: 639 AVAAEDFEGAMRALATLRPPVDAFFDKVTVNAEDAALRANRLALLNALREATRAVADFAR 698

Query: 701 I 701
           I
Sbjct: 699 I 699


>gi|27377647|ref|NP_769176.1| glycyl-tRNA synthetase subunit beta [Bradyrhizobium japonicum USDA
           110]
 gi|81841876|sp|Q89S69|SYGB_BRAJA RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|27350792|dbj|BAC47801.1| glycyl-tRNA synthetase beta chain [Bradyrhizobium japonicum USDA
           110]
          Length = 699

 Score =  679 bits (1752), Expect = 0.0,   Method: Composition-based stats.
 Identities = 311/720 (43%), Positives = 435/720 (60%), Gaps = 42/720 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA+DL  ++   L  EG++Y+  + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAADDLRRMVTDKLVAEGLVYEGAKAFATPRRLALTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+   ER GP++GA   A+ GFL++TGL+++ + +I++DP KGD Y+A++ KP R  
Sbjct: 61  ARQPDLKTERRGPKMGAPDAAVQGFLKATGLKSLDEAKIQRDP-KGDFYIALIEKPGRDA 119

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  I+PV I+  PWPKSMRW        + +W+RPL +I      E  +  ++   +
Sbjct: 120 IDVLAEILPVIIRTFPWPKSMRWGARSGKPGSLNWVRPLHAITATFGLETEEPDVVKFAV 179

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF AP  I V+  + Y   L +A V+LDPE R++AIL DA +LA A G
Sbjct: 180 DGIEAGQTTYGHRFLAPAAINVRRFEDYEAKLLDAKVVLDPERRKDAILTDAKQLAFAQG 239

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT-REGVL 299
            +LVED++LL+E+ GLVEW  V MGSF++++L  P E+IR TI+ NQKCFV    + G L
Sbjct: 240 FDLVEDQNLLDEVAGLVEWPVVLMGSFEEEFLATPAEVIRATIRNNQKCFVVSDAKTGKL 299

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN FILV+NI+A+DGG  I+ GN RV+ ARL DA  F++ D                   
Sbjct: 300 ANKFILVANIEATDGGKTIIAGNERVIRARLSDAKFFYETD------------------- 340

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + +   +VFH ++GTQ  R++RI  L  +IA L+ ADVA   RA  L+K
Sbjct: 341 -LKTKLEDRLPKFEQ--IVFHEELGTQAARITRIERLAAEIAPLVGADVAKTARAAHLAK 397

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPE+QG +GK YA+ Q E+ S   A EEH KP+GP + VPT+ +S+ V+L
Sbjct: 398 ADLLTEVVGEFPEVQGLMGKYYALAQGEDASVAAACEEHYKPQGPADRVPTDPVSVAVAL 457

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR+I EN + + L +            
Sbjct: 458 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLIAENTLRLSLMKVAASALAGLSVK 517

Query: 531 -------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFS 582
                    +L+ FF DRLK+ L ++  RHDL++A+      D+LL IV  +  L +F  
Sbjct: 518 PADVQKLPGDLLTFFADRLKVQLREQGARHDLVDAVFALGGQDDLLMIVRRVDALGKFLE 577

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           S  G+  L   KR   IL+IEEKK++             L  EK L   IS+       S
Sbjct: 578 SDDGKNLLAGTKRASNILSIEEKKDKRTFDGAPDAALYSLGEEKALAKAISEVQAEASAS 637

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +      +  +  P++ FFD+V VN DD +VR+NRL LL  I++    V +  KI
Sbjct: 638 VAKEDFAAAMSAMAKLRPPVDAFFDKVRVNDDDPKVRENRLKLLNEIRSATRAVADFSKI 697


>gi|328544957|ref|YP_004305066.1| glycyl-tRNA synthetase beta subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326414699|gb|ADZ71762.1| Glycyl-tRNA synthetase beta subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 695

 Score =  677 bits (1748), Expect = 0.0,   Method: Composition-based stats.
 Identities = 309/720 (42%), Positives = 432/720 (60%), Gaps = 46/720 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ +AAEDL  ++   L E G+ Y+  + + TP RL L++ GL 
Sbjct: 1   MPDLLLELFSEEIPARMQRRAAEDLKSLVTNALVEAGLTYEGAKAFSTPRRLALHVAGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPRVGA  KA++GFLR  GL +I +  I+ DPKKGD Y+AV+ +P R  
Sbjct: 61  VASSATREERKGPRVGAPDKALEGFLRGAGLSSIDEATIQTDPKKGDFYVAVIERPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D++   +P  ++  PWPKSMRW           W+RPL+SIL     E  + +I+  ++
Sbjct: 121 IDIIAEAMPGIVRAFPWPKSMRWGAGQ-----LRWVRPLQSILATFGPETEEPEIVRFEV 175

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G+ T GHRF A   I+V+  D Y+  LE+  V+LD + R++ IL+DA   A A+G
Sbjct: 176 DGIVSGDTTRGHRFLADAEIRVRRFDDYMPKLEKHKVVLDADRRKDMILHDARDRALALG 235

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
           LELVED+ LLEE+ GLVEW  V  GSF++ +L +P+E IRLTI+ NQKCFV R  + G L
Sbjct: 236 LELVEDEGLLEEVAGLVEWPVVLTGSFEEAFLAIPDECIRLTIRANQKCFVLRDPKTGRL 295

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN F+L SNI  +DGG  +V GN +V+ ARL DA  FW+ D                   
Sbjct: 296 ANRFVLTSNIVPADGGKVVVAGNEKVIRARLSDARFFWETD------------------- 336

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L   + +LD   +VFH K+G+QGERV R+  L  ++A L+ AD     R   L+K
Sbjct: 337 -LKTKLADTLPKLD--GIVFHDKLGSQGERVKRLEALAVELAPLVGADTDKARRGAELAK 393

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL + +V EFPELQG +G+ YA  Q E+ S   AIE+H KP+GP + VPT+ ++I V+L
Sbjct: 394 ADLVSAMVYEFPELQGLMGRYYATAQGEDASVATAIEDHYKPQGPSDRVPTDPVAIAVAL 453

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           +DKLD L  FWAI+EKP+GSKDPYALRRA LG+IRI+LEN + +PL++ I          
Sbjct: 454 SDKLDLLAGFWAIDEKPTGSKDPYALRRAALGVIRIVLENGLRLPLARLIGAAQSNLGIG 513

Query: 531 -------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFS 582
                   ++L+ FF DRLK++L D   RHDLI+A+      D+LL IV  ++ L  F S
Sbjct: 514 LSDPDALVEDLLAFFADRLKVHLKDEGARHDLIDAVFALGGQDDLLMIVRRVEALGTFLS 573

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           +  G   L   +R   IL IEEKK+   +       +L+  AE +L A I      + E+
Sbjct: 574 TDDGANLLAGYRRAVNILRIEEKKDGAPVEGRPHADHLVEPAEIQLAAAIDAARAEVGEA 633

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +      L  +  P++ FF+++LVN +D  VR NRL LL  I+++   V +  ++
Sbjct: 634 LAGEDFEAAMTALAHLRAPVDRFFEEILVNAEDAGVRANRLRLLAEIRDVAGTVADFSRV 693


>gi|49473963|ref|YP_032005.1| glycyl-tRNA synthetase subunit beta [Bartonella quintana str.
           Toulouse]
 gi|49239466|emb|CAF25817.1| Glycyl-tRNA synthetase beta chain [Bartonella quintana str.
           Toulouse]
          Length = 740

 Score =  677 bits (1747), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/739 (45%), Positives = 460/739 (62%), Gaps = 37/739 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPARMQ KAA DL   +I  L   G+ Y+  R+YWTP RL L ++GLS
Sbjct: 1   MSDLLLELFSEEIPARMQRKAAADLKKCVIDQLVNAGLTYKAAREYWTPRRLTLDVRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP   + +  IDGFLR+TGL  IS+  I  DPKKGD Y+A + K  R  
Sbjct: 61  IRSKDIHEERRGPSTKSPQHVIDGFLRTTGLNNISEAPIVHDPKKGDFYIAKIIKKGRSA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PWPKSMRW    +   A  WIRPL++ILC+   E  + ++I   +
Sbjct: 121 EEIIADILPGIIRNFPWPKSMRWGKDSAKSGALKWIRPLQNILCVFGPEIGETRVIPFTI 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   P++++  D YI  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSNGKPLQIRRFDDYITQLEAHKVILDAERRKNIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG+FDK +L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDSALLEEVAGLVEWPVVLMGNFDKSFLDIPPEIIRLTIQANQKCFVTRKQGEKI 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L++ FILVSNI ASD G  I +GNS+VV ARL DAL+FW+ DQ++LP++  L+ SA K 
Sbjct: 301 KLSHNFILVSNILASDEGKEISKGNSKVVCARLSDALYFWQTDQHDLPDIKYLQSSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
            LDL KPLDQRMARLD L+V FH K+GTQG RV RI  L +KIA  + AD  L  RA +L
Sbjct: 361 ALDLKKPLDQRMARLDHLNVTFHEKLGTQGARVERIATLAQKIAPSVQADPLLAKRAAIL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TE+V EFPELQG +G++YA+LQ E+    +AIE+H KP+GP + +P   ++I V
Sbjct: 421 AKADLQTEVVGEFPELQGFMGRKYALLQEEDPRVAEAIEDHYKPQGPKDRIPQEPLAIAV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE------- 530
           +LADK+D L+ FW INEKP+GSKDPYALRRA LGIIR++L     I L            
Sbjct: 481 ALADKIDMLVGFWLINEKPTGSKDPYALRRAALGIIRLVLLRDWKINLMPLFHLATNLFL 540

Query: 531 ---------------------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFH+RLK+YL +  +R+D +EA+L  +
Sbjct: 541 QQKNKDETSRTKTTQSQNLVLEKTEYILSDLLFFFHERLKIYLKEEGVRYDALEAVLNKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D+ L +   ++ L  F +++ G  FL + KRI  IL  E +K   I  EI+P+      
Sbjct: 601 ADDFLLVARRVEALIAFINTSDGGSFLAAVKRIVNILENEIQKGSTIVNEINPELFSETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY VI +    +++ ++     +  + L  + + I+ FF++VLVN  +  +R NRL+
Sbjct: 661 EKQLYQVIIEAEKKVRDHINAINLSRALNTLAPLRKFIDAFFEKVLVNDKNPNIRTNRLA 720

Query: 684 LLQYIKNIILIVINVQKIV 702
           LL+ I N    V +  K+V
Sbjct: 721 LLKRIHNTTQAVADFSKLV 739


>gi|254504740|ref|ZP_05116891.1| glycyl-tRNA synthetase, beta subunit [Labrenzia alexandrii DFL-11]
 gi|222440811|gb|EEE47490.1| glycyl-tRNA synthetase, beta subunit [Labrenzia alexandrii DFL-11]
          Length = 695

 Score =  675 bits (1742), Expect = 0.0,   Method: Composition-based stats.
 Identities = 304/720 (42%), Positives = 421/720 (58%), Gaps = 46/720 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAAEDL  ++   L + G+ Y+  + + TP RL L++ G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAEDLKTLVTNALVDAGLPYEGAKAFATPRRLALHVAGVP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPRVGA +KA++GFLR  GL +I D  I+ DPKKGD Y+AV+ KP R  
Sbjct: 61  AGSAATREERKGPRVGAPEKAVEGFLRGAGLASIDDATIQTDPKKGDFYVAVIEKPGRSA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D++   +P  ++  PWPKSM+W       ++  W+RPL SI+     E  +  ++  + 
Sbjct: 121 IDIIAEFMPGILRNFPWPKSMKWG-----TTSTRWVRPLHSIIATFGPETEEPDVVPFEF 175

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  T GHRF A     V+  D Y   LE+  V+LD + R++ IL DA   A A+G
Sbjct: 176 DGIKSGKTTRGHRFLADVAFDVRRFDDYAPALEKHKVVLDADRRKDIILADAKDRALALG 235

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
           LELVED  LLEE+ GLVEW  V  GSFD+ +L +P+E I+LTIK NQKCFV +  + G L
Sbjct: 236 LELVEDPGLLEEVAGLVEWPVVLTGSFDEAFLEIPDECIQLTIKVNQKCFVLKDPKTGKL 295

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN F+L+SNI A D G  I+ GN +V+ ARL DA  FW  D                   
Sbjct: 296 ANKFVLISNIVAPDDGKLIIAGNEKVIRARLSDAQFFWTSD------------------- 336

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L   + +L+  DV FH K+G+ GERV R+  L  ++A L+ AD A   R   L+K
Sbjct: 337 -LKTNLTDNLPKLN--DVKFHEKLGSVGERVQRLIALSAELAPLVGADEAKAKRGAELAK 393

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL + +V EFPELQG +G+ YA  Q E+ S   AIEEH KP+GP ++VP + ++I V+L
Sbjct: 394 ADLVSAMVFEFPELQGLMGRYYATAQGEDASVATAIEEHYKPQGPSDSVPADPVAIAVAL 453

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-------- 531
           A+KLD L  FWAI+EKP+GSKDPYALRRA LG+IRI+LEN + + L + I          
Sbjct: 454 AEKLDLLTGFWAIDEKPTGSKDPYALRRAALGVIRIVLENNLRLKLGELILSALKAQSAI 513

Query: 532 --------QNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFS 582
                    +L+ FF DRLK++L D  +RHDLI+A+      D+LL +V  ++ L +F S
Sbjct: 514 ADDEAALVADLLSFFADRLKVHLKDEGMRHDLIDAVFALDGQDDLLMVVKRVEALQKFVS 573

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           S  G       KR   IL  EEKK+   ++ +    +L  +AE  L   I        E+
Sbjct: 574 SDDGTNLAAGYKRAVNILKAEEKKDGTPVTGKPHADHLSEQAEIDLAVAIDTARAEAAEA 633

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +    + L  +  P++ FF+ +LVN DD  +R NRL LL  I++   +V +  K+
Sbjct: 634 VKSENFEGAMEALSKLRAPVDRFFEDILVNADDPALRMNRLQLLAEIRDATHVVADFSKV 693


>gi|254465195|ref|ZP_05078606.1| glycyl-tRNA synthetase, beta subunit [Rhodobacterales bacterium
           Y4I]
 gi|206686103|gb|EDZ46585.1| glycyl-tRNA synthetase, beta subunit [Rhodobacterales bacterium
           Y4I]
          Length = 699

 Score =  674 bits (1739), Expect = 0.0,   Method: Composition-based stats.
 Identities = 286/722 (39%), Positives = 412/722 (57%), Gaps = 46/722 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AAEDL   +   L E G+ Y       TP RL L + GL 
Sbjct: 1   MPDLLIELFSEEIPARMQARAAEDLKKRVTDGLVEAGLTYAGAAALSTPRRLTLAVDGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+VGA  KAI+GFLR  GL    D   +++  KG VY A++ KP R  
Sbjct: 61  AESPTVREERKGPKVGAPDKAIEGFLRGAGLT--RDQLEERETPKGAVYFALIEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        A  W+RPL SILCIL  E+    ++DLD+
Sbjct: 119 AEIIAEVLEDTIRNFPWPKSMRWGAG-----ALRWVRPLHSILCILSDEN-GTSVVDLDI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T GHRF AP  I V   D Y   L+ A V+LD   R  AI  +A   A A G
Sbjct: 173 DGIKSGNTTRGHRFMAPEKITVTGFDDYAAKLKRAFVVLDARERAEAIWQEATNQAFASG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           L++VEDK LL E+ GLVEW  V MGS D ++L LP E+++ ++K +QK F  +  +    
Sbjct: 233 LDVVEDKGLLAEVAGLVEWPVVLMGSIDAEFLELPPEVLQTSMKEHQKFFSVKNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N + +D GA I+ GN +V++ARL DA  FW+ D     + + +          
Sbjct: 293 EKFITVANRETADNGATILAGNQKVLSARLADAKFFWENDLRTAKSEAGMGV-------- 344

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                   +  L   +V FH K+GTQ  R+ RI  L ++IA ++ AD  L ++A  ++KA
Sbjct: 345 -------WVENLS--NVTFHNKLGTQAARIDRIAALAREIAPVVGADADLAEQAARVAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA       +  +A E+H  P GP ++VP+  +S+ V+LA
Sbjct: 396 DLSSEMVYEFPELQGLMGRYYAEAAGLPQAVANACEQHYSPLGPGDDVPSEPVSVAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS-------------- 526
           DKLDTL  FWAI+EKP+GSKDPYALRRA LG+IR++LEN + +PL+              
Sbjct: 456 DKLDTLTGFWAIDEKPTGSKDPYALRRAALGVIRLVLENDVRMPLNMVFGKAAEITGKRE 515

Query: 527 -----QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEF 580
                 F +  +L  FFHDRLK++L D+ IRHD+I+A +    +D+L  +V   + L +F
Sbjct: 516 GASGEAFADVNDLRGFFHDRLKVFLRDQGIRHDVIDACIAMDGSDDLTLLVKRARALEDF 575

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
             +  GE  L   KR   IL+  E+K+  E S     ++   E EK L+  +   G  I 
Sbjct: 576 LKTEDGENLLQGFKRANNILSQAEEKDGVEYSYGADRKFAEDETEKALFDALEAGGAAIS 635

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +++ + +      + ++  P++ FF+ V VN ++  +R NRL+LL  I+ +   V ++ 
Sbjct: 636 PAIEAEDFAAAMRGMAALRAPVDAFFEAVQVNAENEVLRRNRLNLLSQIRQVCGQVADLT 695

Query: 700 KI 701
           K+
Sbjct: 696 KV 697


>gi|75676770|ref|YP_319191.1| glycyl-tRNA synthetase subunit beta [Nitrobacter winogradskyi
           Nb-255]
 gi|74421640|gb|ABA05839.1| glycyl-tRNA synthetase beta chain [Nitrobacter winogradskyi Nb-255]
          Length = 727

 Score =  674 bits (1738), Expect = 0.0,   Method: Composition-based stats.
 Identities = 304/747 (40%), Positives = 433/747 (57%), Gaps = 68/747 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA+DL  ++   L  EG++Y+  + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAADDLRRMVTDKLVAEGLVYEGAKAFVTPRRLALTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  +ER GP+VGA   A+ GFL++ GL ++ + +I++DPKKGD Y+A++ +P R  
Sbjct: 61  ARQPDLKDERKGPKVGAPDAAVQGFLKAAGLTSLDEAKIQRDPKKGDFYVALIERPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  ++PV ++  PWPK MRW    +   A +W+RPL SI+     E  + +++  D+
Sbjct: 121 IDVLAELLPVIVRTFPWPKQMRWGERSAKPGALTWVRPLHSIIATFGMETEEPEVVPFDV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
            +I  G  T GHRF AP    V+  + Y   L +A V+LDP+ R++ IL DA  LA A G
Sbjct: 181 ADITAGQATRGHRFMAPGEFSVRRFEDYEAKLHDAKVVLDPQRRKDIILADAKELAFAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
            ELVED+ LL+E+ GLVEW  V MGSFDK++L +P E+IR TI+ NQKCFV    + G L
Sbjct: 241 YELVEDQALLDEVSGLVEWPVVLMGSFDKEFLSIPGEVIRATIRNNQKCFVVNDPKSGKL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN F+LV+N++ASDGG AI+ GN RV+ ARL DA  F++ D                   
Sbjct: 301 ANRFLLVANLEASDGGEAIIAGNERVIRARLADAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + +   +VFH K+GTQ ER++RI  L  +IA L+ ADV    RA  L K
Sbjct: 342 -LKTKLEARLPKFEQ--IVFHEKLGTQAERIARIERLAAEIAPLVGADVEKAKRAARLCK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
            DL TE+V EFPELQG +GK YA+ Q E+ S   A EEH KP+GP + VP++ +SI V+L
Sbjct: 399 TDLLTEVVGEFPELQGLMGKYYALAQGEDASVAAACEEHYKPQGPNDRVPSDPVSIAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-------- 531
           ADK+DTL+ FWAI+EKP+GSKDPYALRRA LG+IR+++ N + + L     +        
Sbjct: 459 ADKIDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLVVNNGLQLKLRHITAEALNLLEEQ 518

Query: 532 -----------------------------------QNLILFFHDRLKLYLHDRDIRHDLI 556
                                              ++L++FF DRLK+ L ++  RHDL+
Sbjct: 519 KPDLVGEARQRWLNQYGGSHSIEAALESAVAAVFVKDLLIFFADRLKVQLREQGARHDLV 578

Query: 557 EAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEI 614
           +A+      D+LL IV  ++ L +F  +  G+  L   KR   ILAIEEKK++       
Sbjct: 579 DAVFALEGQDDLLMIVRRVEALGKFLDTDDGKNLLSGTKRASNILAIEEKKDKRSFDGAP 638

Query: 615 SPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDD 674
                 L  EK L A I         ++  + +      +  +   ++ FF+QV VN  D
Sbjct: 639 DASLYTLGEEKALGAAIDQVKREASAAVATEDFAAAMSAMAKLRPAVDAFFEQVKVNDAD 698

Query: 675 REVRDNRLSLLQYIKNIILIVINVQKI 701
            ++R+NRL LL  I+     V +  KI
Sbjct: 699 PKIRENRLRLLNEIRAATRTVADFSKI 725


>gi|115526402|ref|YP_783313.1| glycyl-tRNA synthetase subunit beta [Rhodopseudomonas palustris
           BisA53]
 gi|115520349|gb|ABJ08333.1| Glycine--tRNA ligase [Rhodopseudomonas palustris BisA53]
          Length = 744

 Score =  671 bits (1731), Expect = 0.0,   Method: Composition-based stats.
 Identities = 317/764 (41%), Positives = 426/764 (55%), Gaps = 85/764 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAAEDL  ++   L  EG++Y+  + + TP RL L + GL 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAAEDLKRLVTDRLVAEGLVYEGAKAFATPRRLALTIHGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  +ER GP+VGA   A+ GFL++TGL ++S+ +I+ DPKKGD Y+A++ KP R  
Sbjct: 61  ARQPDLKDERKGPKVGAPDAAVQGFLKATGLASLSEAKIQSDPKKGDFYIALIEKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  I+PV ++  PWPKSMRW    +   A  W+RPL SI+     E     ++  D+
Sbjct: 121 LDVLAEILPVIVRTFPWPKSMRWGERSAKPGALQWVRPLHSIIATFGLETEDPDVVAFDI 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G +T GHRF AP    V+    Y   L +A V+LDP+ R++ IL DA  LA A  
Sbjct: 181 SGIKAGQVTRGHRFMAPQDFSVRRFADYEAKLYDAKVVLDPQRRKDIILADAKTLAQAQN 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
            ELVED  LL+E+ GLVEW    MGSFDK++L +P E+IR TI+ NQKCFV R    G L
Sbjct: 241 YELVEDPVLLDEVSGLVEWPVALMGSFDKEFLSIPGEVIRATIRNNQKCFVVRDPATGNL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           A  FIL +NI+ASDGGAAI  GN RV+ ARL DA  F++ D                   
Sbjct: 301 APKFILTANIEASDGGAAITAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + D   +VFH K+GTQ ER++RI  L  +IA L+ ADV    RA  L K
Sbjct: 342 -LKTSLESRLPKFDQ--IVFHEKLGTQAERIARIERLAAEIAPLVGADVEKTKRAARLCK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPELQG +GK YA+ Q E+ S   A EEH KP+GP + VP++ +SI V+L
Sbjct: 399 ADLLTEVVGEFPELQGLMGKYYALAQGEDASVAAACEEHYKPQGPTDRVPSDPVSIAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKID----------------- 522
           ADK+DTL+ FWAI+EKP+GSKDPYALRRA LG+IR+ILEN I                  
Sbjct: 459 ADKIDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLILENGIRTTLSKCMMFGHKQVSTK 518

Query: 523 ----------------------------IPLSQFIEDQNLILFFH--------------- 539
                                       +   +   D ++ LF H               
Sbjct: 519 LFRFSSANFRAHIATILGVLSPDATERVLAAREIDFDTSVALFHHEKGSADTEQLLSFVV 578

Query: 540 DRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQ 598
           DRLK+ L D+  RHDL++A+      D+LL +V  ++ L  F ++  G+  L   KR   
Sbjct: 579 DRLKVQLRDQGARHDLVDAVFALGGQDDLLMVVRRVEALAAFLATDDGKNLLAGVKRAAN 638

Query: 599 ILAIEEKKN-REISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSI 657
           IL IEEKK+ R             + EK L A I         ++  + +      +  +
Sbjct: 639 ILRIEEKKDSRAFDGAPDAALYASDEEKALAAAIDQAKVEASSAVAKEDFSAAMSAMAKL 698

Query: 658 CEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
              ++ FF++V VN DD+ VR+NRL LL  I+     V +  KI
Sbjct: 699 RPAVDAFFEKVKVNDDDKAVRENRLKLLNEIRAATRAVADFSKI 742


>gi|315122428|ref|YP_004062917.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495830|gb|ADR52429.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 700

 Score =  671 bits (1731), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/702 (77%), Positives = 609/702 (86%), Gaps = 3/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M  FLLEIYSEEIPARMQ KA EDL   +  LLKE G+ Y+++RQYWTP RLF+YLKGL+
Sbjct: 2   MLGFLLEIYSEEIPARMQRKATEDLGKNVTRLLKEYGLSYESIRQYWTPRRLFVYLKGLT 61

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
           P SPEKIEERLGPRVGA +KAI+GFL STGL+ ISDC+IKKDPKKGD+YLAV++KPKRL 
Sbjct: 62  PSSPEKIEERLGPRVGASQKAIEGFLHSTGLKKISDCKIKKDPKKGDLYLAVIKKPKRLA 121

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++K IVP+AIQ VPWPKSMRWST +SP+S FSWIRPL+SILC+L +++ K  IIDL+L
Sbjct: 122 EDIIKEIVPIAIQNVPWPKSMRWSTNNSPVSDFSWIRPLQSILCVLFSKEGKSTIIDLNL 181

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
           K IPCGNITYGHRFHAP PIKV+ LD YI  LE+A VLLDPE RRN IL DA  L+S  G
Sbjct: 182 KGIPCGNITYGHRFHAPQPIKVKCLDSYISGLEKAKVLLDPEHRRNTILRDARLLSSVNG 241

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           +ELVED  LLEEI+GLVEWVQV +GSFD+KYLCLPEELIRLTIKTNQKCFVTRTR+G LA
Sbjct: 242 VELVEDDGLLEEIVGLVEWVQVLIGSFDEKYLCLPEELIRLTIKTNQKCFVTRTRQGKLA 301

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSNIQASDGG AIVQGNS+VVAARLEDALHFWKRDQ NLP++ SLKESALKFNLD
Sbjct: 302 NRFILVSNIQASDGGIAIVQGNSKVVAARLEDALHFWKRDQENLPDIDSLKESALKFNLD 361

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           LSKPLDQRMA+LD L+VVFHAKIGTQGERVSRIR+LGKKIAQLI  D+ALVDRA VL KA
Sbjct: 362 LSKPLDQRMAKLDALNVVFHAKIGTQGERVSRIRLLGKKIAQLIGVDIALVDRAAVLLKA 421

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DLCT+IVREFPELQGKIGKEYA LQ  N +   AIEEHLKPRGPLE VPT+KISIT+SLA
Sbjct: 422 DLCTDIVREFPELQGKIGKEYANLQ--NETIVLAIEEHLKPRGPLETVPTDKISITLSLA 479

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHD 540
           DKLDTLINFWAINEKPSGS+DPYALRRA LGIIRIILENKI IPLSQF+EDQNLILFFH 
Sbjct: 480 DKLDTLINFWAINEKPSGSQDPYALRRAALGIIRIILENKIHIPLSQFVEDQNLILFFHV 539

Query: 541 RLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQIL 600
           RLKLYL +  IRHDLIEAIL+PENDNLL IVDLIK+LNEFF+S KG+ FL SAKRI QIL
Sbjct: 540 RLKLYLREIGIRHDLIEAILQPENDNLLVIVDLIKYLNEFFNSEKGKNFLFSAKRILQIL 599

Query: 601 AIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEP 660
           AIEEKK REI L I+PQ   LEAEK+LY VISD   HI++SM +  YH+IGDLL S+ EP
Sbjct: 600 AIEEKKGREI-LPIAPQKFSLEAEKKLYTVISDLDLHIKDSMHNNAYHRIGDLLFSLHEP 658

Query: 661 IEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV 702
           IE FFD V+VNV+D+EVR+NRL+LLQ  K II+ V ++QKIV
Sbjct: 659 IESFFDNVMVNVEDQEVRNNRLALLQCTKKIIMKVFDIQKIV 700


>gi|306842309|ref|ZP_07474969.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. BO2]
 gi|306287566|gb|EFM59022.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. BO2]
          Length = 777

 Score =  671 bits (1731), Expect = 0.0,   Method: Composition-based stats.
 Identities = 346/775 (44%), Positives = 457/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EEIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDEAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FW I+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWGIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLATENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEEDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  ++P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADWVNPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDVNVRANRLALLDQIRAATGKVADFSKI 775


>gi|306845032|ref|ZP_07477613.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. BO1]
 gi|306274664|gb|EFM56453.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. BO1]
          Length = 777

 Score =  670 bits (1730), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 456/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQVHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQSDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQREEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAQKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDEAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLATENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEEDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++       E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREAGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDVNVRANRLALLDQIRAATGKVADFSKI 775


>gi|259416308|ref|ZP_05740228.1| glycyl-tRNA synthetase, beta subunit [Silicibacter sp. TrichCH4B]
 gi|259347747|gb|EEW59524.1| glycyl-tRNA synthetase, beta subunit [Silicibacter sp. TrichCH4B]
          Length = 687

 Score =  670 bits (1728), Expect = 0.0,   Method: Composition-based stats.
 Identities = 285/710 (40%), Positives = 417/710 (58%), Gaps = 34/710 (4%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D L+E++SEEIPARMQ +A EDL   +   L E G+ Y       TP RL L ++GL 
Sbjct: 1   MADLLIELFSEEIPARMQARAGEDLKKRMTDGLVEAGLTYAGAHALTTPRRLTLAIEGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
            HSP   EER GP+VGA +KAI+GFLR  GL    D   ++D  KG VY A++ KP R  
Sbjct: 61  DHSPTVREERKGPKVGAPEKAIEGFLRGAGLS--RDQLEERDTPKGAVYFAIIEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL SILC+L  ED   +++ LD+
Sbjct: 119 AEIIAEVLEDTIRNFPWPKSMRWGAG-----SLRWVRPLHSILCVLTRED-GSEVVSLDI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G+ T+GHRF AP  I V S + Y   L+ A V+LDP+ R  AI  DA   A A G
Sbjct: 173 DGITSGDATWGHRFMAPARISVTSFEDYAAKLKRAFVVLDPKEREAAIWQDATNQAFASG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V+DK LL E+ GLVEW  V MGS D ++L LP E+++ ++K +QK F  +  +    
Sbjct: 233 LEVVDDKGLLAEVAGLVEWPVVLMGSIDAEFLDLPPEVLQTSMKEHQKFFSVKNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N + +D GA I+ GN +V++ARL DA  FW+ D     +              
Sbjct: 293 EKFITVANRETADNGATILAGNQKVLSARLADAKFFWENDLRIAKSEVG----------- 341

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               ++  +  L   +V FH K+GTQ  R+ RI  L ++IA ++ AD  L ++A  ++KA
Sbjct: 342 ----MEGWLESLG--NVTFHNKLGTQAARIDRIAALAREIAPVVGADADLAEQAAKVAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA          +A ++H  P GP + VPT  +S+ V++A
Sbjct: 396 DLSSEMVYEFPELQGLMGRYYAQAAGLPQEVANACQQHYSPLGPSDEVPTEPVSVAVAMA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS-------QFIEDQN 533
           DK+DTL  FWAI+EKP+GSKDPYALRRA LG+IR++LEN + + LS       +  ++ +
Sbjct: 456 DKIDTLTGFWAIDEKPTGSKDPYALRRAALGVIRLVLENGVRVALSGVFTQGYEGADESD 515

Query: 534 LILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLS 592
           L+ FFHDRLK++L D+ IRHD+I+A +    ND+L  +V   + L  F SS  GE  L  
Sbjct: 516 LLSFFHDRLKVFLRDQGIRHDVIDACIAMEGNDDLTLLVKRARALEAFMSSEDGENLLQG 575

Query: 593 AKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIG 651
            KR   IL+  E+K+  E S     +++   AE  L+  ++     I  +++ + +    
Sbjct: 576 FKRANNILSQAEEKDGVEYSYGADKKFIEDAAEAALFDALAANEGAISSAIEAEDFAAAM 635

Query: 652 DLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + ++  P++ FF+ V VN D++ VR NRL+LL  I+ +   V ++ +I
Sbjct: 636 GGMAALRAPVDAFFEAVQVNSDNQVVRRNRLNLLSQIRKVCGQVADLSRI 685


>gi|23501308|ref|NP_697435.1| glycyl-tRNA synthetase subunit beta [Brucella suis 1330]
 gi|161618379|ref|YP_001592266.1| glycyl-tRNA synthetase subunit beta [Brucella canis ATCC 23365]
 gi|254703758|ref|ZP_05165586.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 3 str. 686]
 gi|260566988|ref|ZP_05837458.1| glycyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261754404|ref|ZP_05998113.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 3 str. 686]
 gi|23347197|gb|AAN29350.1| glycyl-tRNA synthetase, beta subunit [Brucella suis 1330]
 gi|161335190|gb|ABX61495.1| glycyl-tRNA synthetase, beta subunit [Brucella canis ATCC 23365]
 gi|260156506|gb|EEW91586.1| glycyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261744157|gb|EEY32083.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 3 str. 686]
          Length = 777

 Score =  669 bits (1726), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 456/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNEFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR +L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRPLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|163842686|ref|YP_001627090.1| glycyl-tRNA synthetase subunit beta [Brucella suis ATCC 23445]
 gi|163673409|gb|ABY37520.1| glycyl-tRNA synthetase, beta subunit [Brucella suis ATCC 23445]
          Length = 777

 Score =  669 bits (1726), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 457/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLATENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|254701212|ref|ZP_05163040.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 5 str. 513]
 gi|261751750|ref|ZP_05995459.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 5 str. 513]
 gi|261741503|gb|EEY29429.1| glycyl-tRNA synthetase subunit beta [Brucella suis bv. 5 str. 513]
          Length = 777

 Score =  669 bits (1726), Expect = 0.0,   Method: Composition-based stats.
 Identities = 349/775 (45%), Positives = 458/775 (59%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  IL DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIILQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|225851940|ref|YP_002732173.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis ATCC
           23457]
 gi|254693188|ref|ZP_05155016.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 3 str.
           Tulya]
 gi|254707863|ref|ZP_05169691.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M163/99/10]
 gi|254709553|ref|ZP_05171364.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis B2/94]
 gi|254716617|ref|ZP_05178428.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M13/05/1]
 gi|256031047|ref|ZP_05444661.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M292/94/1]
 gi|256044124|ref|ZP_05447031.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060541|ref|ZP_05450709.1| glycyl-tRNA synthetase subunit beta [Brucella neotomae 5K33]
 gi|261213429|ref|ZP_05927710.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 3 str.
           Tulya]
 gi|261218417|ref|ZP_05932698.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M13/05/1]
 gi|261315353|ref|ZP_05954550.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M163/99/10]
 gi|261317081|ref|ZP_05956278.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis B2/94]
 gi|261324535|ref|ZP_05963732.1| glycyl-tRNA synthetase subunit beta [Brucella neotomae 5K33]
 gi|265988118|ref|ZP_06100675.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M292/94/1]
 gi|225640305|gb|ACO00219.1| glycyl-tRNA synthetase, beta subunit [Brucella melitensis ATCC
           23457]
 gi|260915036|gb|EEX81897.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 3 str.
           Tulya]
 gi|260923506|gb|EEX90074.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M13/05/1]
 gi|261296304|gb|EEX99800.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis B2/94]
 gi|261300515|gb|EEY04012.1| glycyl-tRNA synthetase subunit beta [Brucella neotomae 5K33]
 gi|261304379|gb|EEY07876.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M163/99/10]
 gi|264660315|gb|EEZ30576.1| glycyl-tRNA synthetase subunit beta [Brucella pinnipedialis
           M292/94/1]
          Length = 777

 Score =  669 bits (1725), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 457/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|17987812|ref|NP_540446.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis bv. 1 str.
           16M]
 gi|17983538|gb|AAL52710.1| glycyl-tRNA synthetase beta chain [Brucella melitensis bv. 1 str.
           16M]
          Length = 780

 Score =  668 bits (1724), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 457/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 4   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 63

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 64  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 123

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 124 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 183

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 184 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 243

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 244 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 303

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 304 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 363

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 364 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 423

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 424 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 483

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 484 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 543

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 544 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 603

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 604 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 663

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 664 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 723

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 724 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 778


>gi|260168178|ref|ZP_05754989.1| glycyl-tRNA synthetase subunit beta [Brucella sp. F5/99]
          Length = 777

 Score =  668 bits (1724), Expect = 0.0,   Method: Composition-based stats.
 Identities = 349/775 (45%), Positives = 458/775 (59%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++I  L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMIIDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGGVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|294851785|ref|ZP_06792458.1| glycyl-tRNA synthetase beta subunit [Brucella sp. NVSL 07-0026]
 gi|294820374|gb|EFG37373.1| glycyl-tRNA synthetase beta subunit [Brucella sp. NVSL 07-0026]
          Length = 777

 Score =  668 bits (1724), Expect = 0.0,   Method: Composition-based stats.
 Identities = 347/775 (44%), Positives = 456/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATTYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I   AH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQYAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|225626913|ref|ZP_03784952.1| glycyl-tRNA synthetase, beta subunit [Brucella ceti str. Cudo]
 gi|225618570|gb|EEH15613.1| glycyl-tRNA synthetase, beta subunit [Brucella ceti str. Cudo]
          Length = 780

 Score =  668 bits (1724), Expect = 0.0,   Method: Composition-based stats.
 Identities = 349/775 (45%), Positives = 458/775 (59%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++I  L + G+ Y+    YWTP RL L ++GL+
Sbjct: 4   MPDLLLELFSEEIPARMQRKAAGDLKKMIIDGLVDAGLTYEAATAYWTPRRLALDIRGLT 63

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 64  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 123

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 124 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 183

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 184 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 243

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 244 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 303

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 304 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 363

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 364 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 423

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 424 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 483

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 484 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 543

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 544 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGGVDGEQDVDNALANYEKEIRAEAEAS 603

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 604 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 663

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 664 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 723

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 724 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 778


>gi|121602631|ref|YP_988699.1| glycyl-tRNA synthetase subunit beta [Bartonella bacilliformis
           KC583]
 gi|120614808|gb|ABM45409.1| glycyl-tRNA synthetase, beta subunit [Bartonella bacilliformis
           KC583]
          Length = 740

 Score =  668 bits (1723), Expect = 0.0,   Method: Composition-based stats.
 Identities = 336/739 (45%), Positives = 460/739 (62%), Gaps = 37/739 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPARMQ KAA DL   +   L + G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MSDLLLELFSEEIPARMQRKAAADLKKCVTNKLVDAGLTYKAACEYWTPRRLTLDIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP   + ++ IDGFLR+TGL  IS+  I  D KKGD Y+A + K  R+ 
Sbjct: 61  TKSQDIYEERKGPSTQSPQQVIDGFLRATGLNNISEAHIAHDNKKGDFYIAKIIKKGRIA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  I+P  ++  PWPKSMRW    +   A  WIR L++ILC+   +  +  II   +
Sbjct: 121 EDIIAEILPDILRNFPWPKSMRWGEDSAKSGALRWIRSLQNILCVFGPQCGETHIIPFTI 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   PI ++  D YI  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSDGKPIPIRRFDDYIAQLEAHKVILDAERRKNIILVDAKNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EG 297
           GLELVED  L+EE+ GLVEW  V MG+FDK +L +P E+IRLTI+ NQKCFVTR +  + 
Sbjct: 241 GLELVEDDPLIEEVAGLVEWPVVLMGNFDKAFLDIPPEIIRLTIRANQKCFVTRKQGEKT 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L++ F+LVSNI ASD G  I++GNS+VV ARL DAL+FW++DQ +L N++ LK SA KF
Sbjct: 301 KLSSHFVLVSNILASDEGKEIIKGNSKVVHARLSDALYFWQKDQCDLFNIADLKSSAEKF 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A LD L+V FHAK+GTQGE+V RI  L +KIA ++ AD  L  RA VL
Sbjct: 361 DLDLNKPLDQRIANLDRLNVTFHAKLGTQGEKVERISALVQKIAPIVQADSTLAKRAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEIV EFPELQG +GK YA+LQ E+    +AIE+H +P GP + +P   ++I V
Sbjct: 421 AKADLQTEIVNEFPELQGFMGKTYALLQGEDPRVAEAIEDHYRPLGPTDRIPQEPVTIAV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------ 531
           +LADK+DTL+ FW INEKP+ SKDPYALRRA LG+I+++L +   I L+           
Sbjct: 481 ALADKIDTLVGFWLINEKPTSSKDPYALRRAALGVIKLVLSHNCKINLTSLFHQAINIFL 540

Query: 532 ----------------------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ F H+RLK++L D  +RHD+IEA+L   
Sbjct: 541 QQKTEYAAYLKESKQTQDTLVKEIDDILSDLLSFLHERLKIHLKDEGVRHDIIEAVLTKN 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D+   IV  I+ L  F ++  G   L + KR   IL  E KK  E +  I+ +  +   
Sbjct: 601 ADDFSLIVHRIEVLTSFINTNNGNNLLAAIKRAVNILENESKKGNEFASTINLELFIENE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  I      + + ++   +    + L S+ EPI+ FF++VLVN  +  +R NRL+
Sbjct: 661 EKQLYQAIIAAEKKVNDHINTTDWLSALNALASLKEPIDKFFEKVLVNDKNAAIRANRLA 720

Query: 684 LLQYIKNIILIVINVQKIV 702
           LL++I  I   + +  KI+
Sbjct: 721 LLEFIHTITQDIADFSKII 739


>gi|148560042|ref|YP_001258428.1| glycyl-tRNA synthetase subunit beta [Brucella ovis ATCC 25840]
 gi|148371299|gb|ABQ61278.1| glycyl-tRNA synthetase, beta subunit [Brucella ovis ATCC 25840]
          Length = 777

 Score =  668 bits (1723), Expect = 0.0,   Method: Composition-based stats.
 Identities = 347/775 (44%), Positives = 456/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPY LRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYVLRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|126728902|ref|ZP_01744717.1| glycyl-tRNA synthetase subunit beta [Sagittula stellata E-37]
 gi|126710832|gb|EBA09883.1| glycyl-tRNA synthetase subunit beta [Sagittula stellata E-37]
          Length = 703

 Score =  667 bits (1722), Expect = 0.0,   Method: Composition-based stats.
 Identities = 276/727 (37%), Positives = 397/727 (54%), Gaps = 52/727 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA DL  ++   L E G+ Y +   + TP RL L ++GL+
Sbjct: 1   MPDLLIELFSEEIPARMQARAAGDLKKMMTDGLVEAGLTYASAAAFHTPRRLCLTVEGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+VGA  KA++GF+R  G+    D   +++ KKG  Y A +  P R  
Sbjct: 61  AESPTLKEERRGPKVGAPDKALEGFMRGAGVT--RDQLEEREDKKGAFYYATVTTPGRKA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E ++   +   ++  PWPKSMRW        +  W+RPL  ILC++  E   E ++DL++
Sbjct: 119 EAIVAEQLEKTVRGFPWPKSMRWG-----TGSLRWVRPLHRILCLMRDE-GGEHVVDLEI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  T GHRF    P +V S + Y   L+ A V+L  E R   I NDA  +A A G
Sbjct: 173 DGIRAGRTTEGHRFMGGAPFEVTSFEDYAAKLKRAHVILSAEERAEHIWNDATNMAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           L++VEDK LL E+ GLVEW  V MG  +  +L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LDVVEDKGLLAEVAGLVEWPVVLMGDIEDTFLGLPPEVLQTSMKEHQKFFSVRNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+NI+ +D GA I+ GN +V+AARL DA  FW+ D     +              
Sbjct: 293 EKFVTVANIETADNGATILAGNQKVLAARLSDAKFFWENDLRVAKDAG------------ 340

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L     RL+  DV FH K+G+Q  R+ RI  L + +A  + AD     +A  ++KA
Sbjct: 341 ----LTAWTDRLE--DVTFHNKLGSQKARIERIAALARDLAPKVGADTDRAAQAAEVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA           A +EH  P GP ++VPT   S+ V+LA
Sbjct: 395 DLSSEMVYEFPELQGLMGRYYAEAAGLPADVAAACQEHYSPLGPSDDVPTAPTSVAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQ------------- 527
           DKLDTL  FWAI+EKP+GSKDPYALRRA LG+IR++L N + I LS              
Sbjct: 455 DKLDTLTGFWAIDEKPTGSKDPYALRRAALGVIRLVLGNGLRISLSDVISEALENVGAAR 514

Query: 528 -----------FIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIK 575
                        +D +L+ FFHDRLK+YL D+ + HD+I+A L    ND+L  +V   +
Sbjct: 515 PNPQDEDDYTGLDKDLDLLAFFHDRLKVYLRDQGVSHDVIDASLAMDGNDDLTLLVKRAE 574

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDF 634
            L     +  G   +   KR   IL   E+K+  E S     ++   + E+ L+  +   
Sbjct: 575 ALAAVMQTEDGRNLVQGFKRANNILTQAEEKDGVEYSFGADVKFAETDEERALFEALDAA 634

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
              I  +M  + +    + + ++  PI+ FFD V VN ++  VR NRL+LL  I+   L 
Sbjct: 635 DKKIAPAMQAEDFTAAMEAMATLRAPIDAFFDAVQVNSENSVVRRNRLNLLSRIRQTCLQ 694

Query: 695 VINVQKI 701
           + ++ KI
Sbjct: 695 IADLTKI 701


>gi|256368860|ref|YP_003106366.1| glycyl-tRNA synthetase, beta subunit [Brucella microti CCM 4915]
 gi|255999018|gb|ACU47417.1| glycyl-tRNA synthetase, beta subunit [Brucella microti CCM 4915]
          Length = 777

 Score =  667 bits (1722), Expect = 0.0,   Method: Composition-based stats.
 Identities = 348/775 (44%), Positives = 457/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDMHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|256159111|ref|ZP_05456932.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M490/95/1]
 gi|256254450|ref|ZP_05459986.1| glycyl-tRNA synthetase subunit beta [Brucella ceti B1/94]
 gi|265997583|ref|ZP_06110140.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M490/95/1]
 gi|262552051|gb|EEZ08041.1| glycyl-tRNA synthetase subunit beta [Brucella ceti M490/95/1]
          Length = 777

 Score =  667 bits (1721), Expect = 0.0,   Method: Composition-based stats.
 Identities = 349/775 (45%), Positives = 458/775 (59%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++I  L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMIIDGLVDAGLTYEAATAYWTPRRLVLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|254718585|ref|ZP_05180396.1| glycyl-tRNA synthetase subunit beta [Brucella sp. 83/13]
 gi|265983560|ref|ZP_06096295.1| glycyl-tRNA synthetase subunit beta [Brucella sp. 83/13]
 gi|306839898|ref|ZP_07472696.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. NF 2653]
 gi|264662152|gb|EEZ32413.1| glycyl-tRNA synthetase subunit beta [Brucella sp. 83/13]
 gi|306405084|gb|EFM61365.1| glycyl-tRNA synthetase, beta subunit [Brucella sp. NF 2653]
          Length = 777

 Score =  664 bits (1714), Expect = 0.0,   Method: Composition-based stats.
 Identities = 346/775 (44%), Positives = 455/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFL   GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLCKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDEAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLATENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVYLKDEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEEDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++       +++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREAGDAIVRED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|62289391|ref|YP_221184.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 1 str.
           9-941]
 gi|82699319|ref|YP_413893.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis biovar
           Abortus 2308]
 gi|189023643|ref|YP_001934411.1| glycyl-tRNA synthetase subunit beta [Brucella abortus S19]
 gi|237814878|ref|ZP_04593876.1| glycyl-tRNA synthetase, beta subunit [Brucella abortus str. 2308 A]
 gi|254688705|ref|ZP_05151959.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 6 str.
           870]
 gi|254729738|ref|ZP_05188316.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 4 str.
           292]
 gi|256256952|ref|ZP_05462488.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 9 str.
           C68]
 gi|260545857|ref|ZP_05821598.1| glycyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260754182|ref|ZP_05866530.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 6 str.
           870]
 gi|260757402|ref|ZP_05869750.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 4 str.
           292]
 gi|260883207|ref|ZP_05894821.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 9 str.
           C68]
 gi|297247804|ref|ZP_06931522.1| glycyl-tRNA synthetase beta subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62195523|gb|AAX73823.1| GlyS, glycyl-tRNA synthetase, beta subunit [Brucella abortus bv. 1
           str. 9-941]
 gi|82615420|emb|CAJ10389.1| Glycyl-tRNA synthetase, beta subunit:Heterodimeric glycyl-transfer
           RNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189019215|gb|ACD71937.1| Glycyl-tRNA synthetase, beta subunit [Brucella abortus S19]
 gi|237789715|gb|EEP63925.1| glycyl-tRNA synthetase, beta subunit [Brucella abortus str. 2308 A]
 gi|260097264|gb|EEW81139.1| glycyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260667720|gb|EEX54660.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 4 str.
           292]
 gi|260674290|gb|EEX61111.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 6 str.
           870]
 gi|260872735|gb|EEX79804.1| glycyl-tRNA synthetase subunit beta [Brucella abortus bv. 9 str.
           C68]
 gi|297174973|gb|EFH34320.1| glycyl-tRNA synthetase beta subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 777

 Score =  662 bits (1709), Expect = 0.0,   Method: Composition-based stats.
 Identities = 347/775 (44%), Positives = 456/775 (58%), Gaps = 74/775 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++  +VP  I+  PWPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+
Sbjct: 121 EDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E  +  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERCKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDAS 300

Query: 298 -------------VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNL 344
                         L+N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++L
Sbjct: 301 RLASPAPQHEEIQALSNKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDL 360

Query: 345 PNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLI 404
           P+L  L  SA KF LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+
Sbjct: 361 PDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLV 420

Query: 405 DADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGP 464
            AD  L  RA VL+KADL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP
Sbjct: 421 GADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGP 480

Query: 465 LENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP 524
            + VP N +S+ V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   P
Sbjct: 481 SDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFP 540

Query: 525 LSQFI-----------EDQNLILF-----------------FHDRLKLYLHD-------- 548
           L                 + L  F                   + L  Y  +        
Sbjct: 541 LLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEAS 600

Query: 549 ----------------------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKG 586
                                    R+D I+A+L PE DNLL +   ++ L  F +   G
Sbjct: 601 CGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDG 660

Query: 587 EKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKR 646
           +  L  AKR   ILA EEKK  +++  + P  L    EK L+  ++     + E++  + 
Sbjct: 661 KNLLAGAKRAANILAAEEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIARED 720

Query: 647 YHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           ++     L  +  P++IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 FNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 775


>gi|240850063|ref|YP_002971456.1| glycyl-tRNA synthetase subunit beta [Bartonella grahamii as4aup]
 gi|240267186|gb|ACS50774.1| glycyl-tRNA synthetase subunit beta [Bartonella grahamii as4aup]
          Length = 740

 Score =  662 bits (1709), Expect = 0.0,   Method: Composition-based stats.
 Identities = 333/739 (45%), Positives = 456/739 (61%), Gaps = 37/739 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPARMQ KAA DL   +   L   G+IY+  R+YWTP RL L ++GLS
Sbjct: 1   MSDLLLELFSEEIPARMQRKAAADLKKSVTDQLVNAGLIYEAAREYWTPRRLTLDIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP + + +  IDGFLR+TGL  IS+  I  D KKG  Y+A + K  R  
Sbjct: 61  IRSKDIHEERRGPSIKSPQHVIDGFLRATGLNDISEAHIGHDDKKGHFYIAKIVKKGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PWPKSMRW    +   A  WIRPL++ILC+   E  +  +I   +
Sbjct: 121 EEIIADILPNIIRNFPWPKSMRWGKDSAQSGALKWIRPLQNILCVFGPEIGETHVIPFTI 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   P +V+  D Y+  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSDGKPFQVRRFDDYVTQLETHKVILDAERRKNIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELV+D  LLEE+ GLVEW  + MG FD+ +L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVQDNPLLEEVAGLVEWPVILMGDFDQSFLDIPPEIIRLTIRANQKCFVTRKQGEKV 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L++ FILVSNI ++D G  I +GNS+VV ARL DAL+FW+ DQ +LP++  L+ S  KF
Sbjct: 301 KLSHHFILVSNILSNDEGKEISKGNSKVVRARLSDALYFWQTDQRDLPDIQQLESSIKKF 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LD+ KPLDQRMARLD L+V FHAK+GTQG RV RI  L ++I+ LI  D  L  RA +L
Sbjct: 361 DLDIKKPLDQRMARLDHLNVTFHAKLGTQGARVERIATLAQEISPLIQTDPLLAKRAAIL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEIV EFPELQG +G++YA+LQ E+     AIE+H KP+GP + +P   ++ITV
Sbjct: 421 AKADLQTEIVGEFPELQGVMGQKYALLQGEDPRVAVAIEDHYKPQGPTDRLPQEPLAITV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE------- 530
            LADK+D L+ FW INEKP+GSKDPYALRRA LG+IR++L     I L    +       
Sbjct: 481 MLADKIDMLVGFWLINEKPTGSKDPYALRRAALGVIRLVLSRDWKINLMPLFQLAMNLFL 540

Query: 531 ---------------------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFHDRLK+YL +   R+D +EA+L  +
Sbjct: 541 KQKNKYEISQRENSQLLNLLPEKTEYILSDLLFFFHDRLKIYLKEEGARYDALEAVLNKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
           +D+ L +   ++ L  F ++  G  F+ S KR   IL  E +K+  I  EI+P+  + + 
Sbjct: 601 SDDFLLVARRVESLIAFINTHDGMNFVASVKRTANILENEFQKSTTIVNEINPELFVEKE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  I +    +   ++      +  +L  + + I+IFF++VLVN    +VR NRL+
Sbjct: 661 EKQLYHAICEVEKQVLAPINATNLSFVLSVLAPLGKLIDIFFEKVLVNDKKPDVRANRLA 720

Query: 684 LLQYIKNIILIVINVQKIV 702
           LL+ I  I   V +  K+V
Sbjct: 721 LLKCIHIITQSVADFSKLV 739


>gi|49475213|ref|YP_033254.1| glycyl-tRNA synthetase subunit beta [Bartonella henselae str.
           Houston-1]
 gi|49238018|emb|CAF27224.1| Glycyl-tRNA synthetase beta chain [Bartonella henselae str.
           Houston-1]
          Length = 740

 Score =  662 bits (1709), Expect = 0.0,   Method: Composition-based stats.
 Identities = 334/739 (45%), Positives = 459/739 (62%), Gaps = 37/739 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPARMQ KAA DL   +   L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MSDLLLELFSEEIPARMQRKAAADLKKSVTDQLVNAGLTYKAAHEYWTPRRLTLNIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP   + +  IDGFLR+TGL  IS   I  D KKGD Y+A + K  R  
Sbjct: 61  IRSKDTHEERKGPSTKSPQHVIDGFLRATGLSDISKAHIAHDHKKGDFYIAKIVKKGRSA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PWPKSMRW        A  WIR L++ILC+   E  +  +I   +
Sbjct: 121 EEIIADILPDIIRNFPWPKSMRWGKDSEKSGALKWIRSLQNILCVFGPEIGETHVIPFTI 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   P++V+  D Y+  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSDGKPLQVRRFDDYVTQLEIHKVILDAERRKNIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELV+D  LLEE++GL+EW  V MG+FDK +L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVKDNALLEEVVGLIEWPVVLMGNFDKSFLNIPPEIIRLTIRANQKCFVTRKQGEKI 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L++ FILVSNI ASD G  I +GNS+VV ARL DAL+FW+ DQ++LP++  L+ SA K 
Sbjct: 301 KLSHHFILVSNILASDEGKEISKGNSKVVCARLSDALYFWQTDQHDLPDIKYLQSSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL KPLDQRMA+LD L+V FHAK+GTQG RV RI +L ++IA L+ AD  L  RA VL
Sbjct: 361 DLDLKKPLDQRMAQLDHLNVTFHAKLGTQGARVERITILAQQIAPLVHADPFLAKRAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEIV EFPELQG +G++YA+LQ E+    +AIE+H KP+GP + +P   ++I V
Sbjct: 421 AKADLQTEIVGEFPELQGLMGRKYALLQGEDPRVAEAIEDHYKPQGPADRIPQEPLAIAV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ----- 532
           +LADK+D L+ FW INEKPS SKDPYALRRA LG+IR++L     I L            
Sbjct: 481 ALADKIDMLVGFWLINEKPSSSKDPYALRRAVLGVIRLVLLRDWKINLMPLFNLTANLFL 540

Query: 533 -----------------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFH+RLK+YL +   R+D++EA+L+ +
Sbjct: 541 QQKTPYGTSRREATQSQNVLPEKTEHILSDLLSFFHERLKIYLKEEGARYDVLEAVLKKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D+LL I   ++ L  F +++ G+ FL + KR   IL  E +K+  I  EI+P+  +   
Sbjct: 601 ADDLLLIARHVEALIAFINTSDGDSFLAAVKRTVNILEAESQKDSTIEDEINPELFIETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  I++    +  S++      + + L  + + I+ FF++VLVN  +  VR NRL+
Sbjct: 661 EKQLYQAITEIEKTVHHSINATNLPHLLNTLTPLGKFIDTFFEKVLVNDKNPHVRTNRLA 720

Query: 684 LLQYIKNIILIVINVQKIV 702
           LL+ I  +     +  K+V
Sbjct: 721 LLKRIHTLTQKAADFSKLV 739


>gi|118590816|ref|ZP_01548217.1| glycyl-tRNA synthetase subunit beta [Stappia aggregata IAM 12614]
 gi|118436792|gb|EAV43432.1| glycyl-tRNA synthetase subunit beta [Stappia aggregata IAM 12614]
          Length = 695

 Score =  662 bits (1708), Expect = 0.0,   Method: Composition-based stats.
 Identities = 304/720 (42%), Positives = 418/720 (58%), Gaps = 46/720 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAAEDL  ++   L + G+ Y+  + + TP RL L++ G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAEDLKSLVTNALVDAGLPYEGAKAFATPRRLALHVAGVP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPRVGA +KA++GFLR  GL +I    I+ DPKKGD Y+AV+ KP R  
Sbjct: 61  AGSAATREERKGPRVGAPEKALEGFLRGAGLTSIDQATIQTDPKKGDFYVAVIEKPGRSA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DV+   +P  ++  PWP +MRW    +      W+RPL SI+     E  +  ++  + 
Sbjct: 121 IDVIAEFMPGILRNFPWPITMRWGAATT-----RWVRPLHSIVATFGPETEEPDVVSFEF 175

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  T GHRF A     V+  D Y   LE+  V+LD + R++ I NDA   A A+G
Sbjct: 176 DGIKAGKTTRGHRFLADEAFDVRRFDDYAPALEKHKVVLDADRRKDIIQNDAKDCALALG 235

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           L+LVED  LLEE+ GLVEW  V  GSFD+ +L +P+E I+LTIK NQKCFV +    G L
Sbjct: 236 LDLVEDPGLLEEVAGLVEWPVVLTGSFDEDFLTIPDECIQLTIKVNQKCFVLKNPATGRL 295

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN F+L+SNI A DGG  IV GN +V+ ARL DA  FW+ D                   
Sbjct: 296 ANKFVLISNIIADDGGKLIVAGNEKVIRARLSDARFFWETD------------------- 336

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L   + +LD  +V FH K+G+ GERV R+  L  ++A +  AD     RA  L+K
Sbjct: 337 -LKSKLSDNLPKLD--EVKFHEKLGSVGERVKRMIALSAELAPVAGADETKAKRAAELAK 393

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL + +V EFPELQG +G+ YA  Q E+ S   AIEEH KP+GP ++VPT+ +++ V+L
Sbjct: 394 ADLVSNMVFEFPELQGLMGRYYATAQGEDASVATAIEEHYKPQGPSDSVPTDPVAVAVAL 453

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-------- 531
           A+KLD L  FWAI+EKP+GSKDPYALRRA LG+IRI+LEN + I L   +          
Sbjct: 454 AEKLDLLAGFWAIDEKPTGSKDPYALRRAALGVIRIVLENNLRIRLGDILRSALDLQGVK 513

Query: 532 --------QNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFS 582
                    +L+ FF DRLK++L D   RHDLI+AI      D++L +V  ++ L +F S
Sbjct: 514 TADPAALVADLLSFFADRLKVHLRDEGARHDLIDAIFALEGQDDVLMVVRRVEALGKFVS 573

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           S  G   L   KR   IL  EEKK+   +S +  P +   +AE  L A I        ++
Sbjct: 574 SDDGTNLLAGYKRAVNILKAEEKKDGAAVSGKPHPDHFQEQAEIDLAAAIDVARAEAADA 633

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +    + L  +  P++ FF  +LVN +D  +R NRL LL  I++   +V +  K+
Sbjct: 634 VASENFEGAMEALSKLRAPVDRFFVDILVNAEDATLRMNRLQLLAEIRDATHVVADFSKV 693


>gi|83952444|ref|ZP_00961175.1| glycyl-tRNA synthetase beta subunit [Roseovarius nubinhibens ISM]
 gi|83836117|gb|EAP75415.1| glycyl-tRNA synthetase beta subunit [Roseovarius nubinhibens ISM]
          Length = 692

 Score =  662 bits (1708), Expect = 0.0,   Method: Composition-based stats.
 Identities = 285/716 (39%), Positives = 408/716 (56%), Gaps = 41/716 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ KAAEDL   +   L E G+ Y     + TP RL L ++G+ 
Sbjct: 1   MPDLLIELFSEEIPARMQAKAAEDLRQRVTDGLVEAGLTYAGAASFSTPRRLTLAIEGML 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GPRV A +KAI+GFLR  G+    D    +D KKG VY AV+ KP R  
Sbjct: 61  AQSPTLREERKGPRVDAPEKAIEGFLRGAGVS--RDELEVRDEKKGQVYFAVISKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  ++   I+  PWPKSMRW        +  W+RPL SILC++  +  +  I+ +D+
Sbjct: 119 EEIVAEVLEQTIRNFPWPKSMRWGAG-----SLRWVRPLHSILCLMTNDAGEAHIVPMDV 173

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G+ T GHRF AP    V S + Y   L+ A V+LDPE R  AI  +A  LA A G
Sbjct: 174 DGITAGDSTEGHRFMAPGRFAVTSFEDYAAKLKRAYVVLDPEERAQAIWQEASNLAFAAG 233

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           +ELVEDK LL E+ GLVEW    MG+ D+ +L LP E+++ ++K +QK F  +  +    
Sbjct: 234 MELVEDKGLLREVAGLVEWPVPLMGAIDEAFLGLPPEVLQTSMKEHQKFFSVKNPKTGRI 293

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D GA I+ GN +V++ARL DA  FW+ D        +           
Sbjct: 294 EKFVTVANRETADHGATILAGNQKVLSARLADAKFFWENDLREAEAGGT----------- 342

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                   +A LD  +V FH K+G+Q  R+ RI  L ++IA +  AD  L ++A   +KA
Sbjct: 343 ------AWLASLD--NVTFHNKLGSQAARIDRIAALAREIAGVTGADADLAEQAARWAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA           A +EH  P GP ++VPT  +S+TV+LA
Sbjct: 395 DLSSEMVYEFPELQGLMGRYYAEKAGLPAEVAGAAQEHYSPLGPSDDVPTAPVSVTVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--------- 531
           DKLDTL  FWAI+EKP+GSKDP+ALRRA LG+IR++LEN + + + + I           
Sbjct: 455 DKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIRLVLENGLSLNMDEAIAKGLGQQPGAT 514

Query: 532 ----QNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKG 586
                +L+ F HDRLK+YL D  +RHD+I+A L    ND+L  +V   + L E   +  G
Sbjct: 515 DGAAADLLSFIHDRLKVYLRDEGLRHDVIDACLAMEGNDDLALVVKRARALGEMLGTEDG 574

Query: 587 EKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHK 645
           E  L   KR   IL+  E K+  E S     ++   E E+ L+A +      I  ++  +
Sbjct: 575 ENLLQGFKRANNILSQAEDKDGVEYSYGADVKFAETEEERALFAALDAAEPKIAAALKAQ 634

Query: 646 RYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            ++     + ++  PI+ FF+ V VN D   VR NRL+LL  I+ ++  V ++ ++
Sbjct: 635 DFNAAMAAMAALRAPIDAFFEAVQVNTDKDVVRRNRLNLLSRIRGLVGSVADLTRV 690


>gi|163742176|ref|ZP_02149564.1| glycyl-tRNA synthetase subunit beta [Phaeobacter gallaeciensis
           2.10]
 gi|161384506|gb|EDQ08887.1| glycyl-tRNA synthetase subunit beta [Phaeobacter gallaeciensis
           2.10]
          Length = 704

 Score =  660 bits (1704), Expect = 0.0,   Method: Composition-based stats.
 Identities = 287/728 (39%), Positives = 415/728 (57%), Gaps = 53/728 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AAEDL   +   L E G+ Y       TP RL L ++GL 
Sbjct: 1   MPDLLIELFSEEIPARMQARAAEDLKKRMTDGLVEAGLTYAGAHALSTPRRLTLAMEGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
            HSP   EER GP+VGA  KAI+GFLR  GL    D   +++  KG VY A++ KP R  
Sbjct: 61  EHSPTVREERKGPKVGAPDKAIEGFLRGAGLT--RDQLEERETPKGAVYFALIEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PW KSMRW        +  W+RPL+SI+C+L  ED   +++ L++
Sbjct: 119 AEIIAEVLEDTIRNFPWSKSMRWG-----TGSLRWVRPLQSIVCLLSKED-GAEVVPLNI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GNITYGHRF AP  I V   D Y   L+ A V+LDP  R  AI  +A   A A G
Sbjct: 173 DGIASGNITYGHRFIAPDQITVTGFDDYAAKLKRAHVVLDPAEREAAIWQEATNQAFASG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VEDK LL E+ GLVEW  V MG+ D ++L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LEVVEDKGLLAEVAGLVEWPVVLMGAIDDEFLALPPEVLQTSMKEHQKFFSVRNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N + +D GA I+ GN +V++ARL DA  FW+ D   +                
Sbjct: 293 EKFITVANRETADNGATILAGNQKVLSARLADAKFFWENDLRTVTE-------------- 338

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
             +  +  + +L   +V FH K+GTQ  R+ RI  L ++IA ++ AD  L ++A  ++KA
Sbjct: 339 --QGFEPWVGKLG--NVTFHNKLGTQAARIDRIAALAREIALVVGADADLAEQAARVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA           A E H  P GP ++VPT  +S+ V+LA
Sbjct: 395 DLSSEMVYEFPELQGLMGRYYAEAAGLPQDVAKACEAHYSPLGPSDDVPTEPVSVAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
           DKLDTL  FWAI+EKP+GSKDP+ALRRA LG+IR++LEN + + L + I           
Sbjct: 455 DKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIRLVLENDVRMGLREIIGLHFSAMENSL 514

Query: 533 -----------------NLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLI 574
                            NL+ FFHDRLK++L D+ IRHD+I+A +    ND+L  +V  +
Sbjct: 515 PADVKKTEHWDAILVEQNLLFFFHDRLKVFLRDQGIRHDVIDACIAMNGNDDLTLLVKRV 574

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISD 633
           + L +F +S  G   L   KR   ILA  E+K+  E S     ++   ++E  L+  ++ 
Sbjct: 575 RALEDFMASDDGPNLLQGFKRANNILAQAEEKDGVEYSYGADKKFAEDDSEIPLFDALAQ 634

Query: 634 FGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIIL 693
               I  +++ + +      + ++  P++ FF+ V VN D+  VR NRL+LL  I+ +  
Sbjct: 635 SEGAISSAIEAEDFAAAMGSMAALRVPVDAFFEAVQVNSDNEVVRRNRLNLLSQIRKVCG 694

Query: 694 IVINVQKI 701
            V ++ +I
Sbjct: 695 QVADLTRI 702


>gi|83955610|ref|ZP_00964190.1| glycyl-tRNA synthetase beta subunit [Sulfitobacter sp. NAS-14.1]
 gi|83839904|gb|EAP79080.1| glycyl-tRNA synthetase beta subunit [Sulfitobacter sp. NAS-14.1]
          Length = 706

 Score =  660 bits (1704), Expect = 0.0,   Method: Composition-based stats.
 Identities = 281/729 (38%), Positives = 408/729 (55%), Gaps = 53/729 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA+DL  ++   L + G+ Y +   + TP RL L ++G+ 
Sbjct: 1   MPDLLIELFSEEIPARMQARAADDLKKLVTNGLVDAGLTYASAAAFSTPRRLTLTIEGML 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP  +EER GP+  A +KAI+GFLR  GL    D   ++D  KG +  A++ KP R  
Sbjct: 61  DASPSLVEERKGPKADAPEKAIEGFLRGAGLT--RDQLEERDTPKGKILFAMINKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW +      +  W+RPL SILCIL AED   + + L +
Sbjct: 119 AEIVADVLETTIRNFPWPKSMRWGSG-----SLRWVRPLHSILCILSAED-GAQTVPLTI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G+ T GHRF AP  I V S D Y   L+ A V+LDP  RR+ I NDA  +A A G
Sbjct: 173 DGITAGDTTRGHRFLAPDTITVSSFDDYSAKLKRAFVVLDPAERRDTIWNDATNMAFANG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VED  LL E+ GLVE+  V MG     +L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LEVVEDAGLLAEVAGLVEYPVVLMGQIGDDFLGLPPEVLQTSMKEHQKFFSVRNPKSGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N   +D GA I+ GN +V++ARL DA  FW+ D     + + ++         
Sbjct: 293 ERFVTVANRTTADDGATILAGNEKVLSARLSDAKFFWENDLRIAQSEAGMQT-------- 344

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                   + RL   +V FH K+GTQ E +SR+  L  ++A  + AD      A   +KA
Sbjct: 345 -------WVDRLS--NVTFHNKLGTQAELISRMEALAGELAPTVGADAEEARAAARFAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G  YA    ++ +   A ++H  P GP ++VPT  +SI V+LA
Sbjct: 396 DLSSEMVYEFPELQGLMGSYYAKAAGKSEAIAAAAQDHYAPLGPSDDVPTAPVSIAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
           +K+D L  FWAI+EKP+GSKDP+ALRRA LG+IRI++EN + + L   I +         
Sbjct: 456 EKIDKLTGFWAIDEKPTGSKDPFALRRAALGVIRILVENDVSLKLRDTILEHLSQAPAPA 515

Query: 533 ---------NLILFFHDRLKLYLHDRDIRHDLIEAILRP----------ENDNLLTIVDL 573
                    NL+ F HDRLK+YL D+ +RHD+I+A +             ND+L  +V  
Sbjct: 516 AGSAEETAENLLSFLHDRLKVYLKDQGVRHDIIDACISSSDGAPAGATEGNDDLTLLVKR 575

Query: 574 IKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVIS 632
            K L+E   +  GE  +   KR   IL+  E  +  E S     ++   E E+ L+A + 
Sbjct: 576 AKALSETLKTDDGENLIQGFKRANNILSQAEDADGVEYSFGADIKFAETEEERALFAALD 635

Query: 633 DFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNII 692
                I+ +M+ + +      + S+  PI+ FFD V VN D+  VR NRL+LL  I+ I 
Sbjct: 636 TAEAQIKPAMEAQDFGTAMSAMASLRGPIDAFFDAVQVNADNATVRRNRLNLLSRIRTIC 695

Query: 693 LIVINVQKI 701
             V ++ KI
Sbjct: 696 SSVADLTKI 704


>gi|89070594|ref|ZP_01157878.1| glycyl-tRNA synthetase beta subunit [Oceanicola granulosus
           HTCC2516]
 gi|89043811|gb|EAR50012.1| glycyl-tRNA synthetase beta subunit [Oceanicola granulosus
           HTCC2516]
          Length = 694

 Score =  660 bits (1702), Expect = 0.0,   Method: Composition-based stats.
 Identities = 272/720 (37%), Positives = 410/720 (56%), Gaps = 47/720 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E+ SEEIPARMQ KA++DL  ++   L E G+ Y +   + TP RL L+++GL+
Sbjct: 1   MPDLLIELLSEEIPARMQAKASDDLKKMVTDGLVEAGLTYASAAAFATPRRLVLHVEGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP+  +ER GP+VGA  KA++GF R  G+   +    ++D  KG  + AV+ +  R  
Sbjct: 61  AESPDTRDERRGPKVGAPDKAVEGFCRGAGVDRAALE--ERDTGKGAFWFAVIERKGRKA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D++  ++   ++  PWPKSMRW +      +  W+RPL SILCIL  E    +++ L++
Sbjct: 119 ADIVAEVLETTVRGFPWPKSMRWGSG-----SLRWVRPLSSILCILSDE-GGAEVVPLEI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
                G +T GHRF AP  I V   + Y   L+ A V+L P+ R  AI NDA  +A + G
Sbjct: 173 DGQRAGAVTRGHRFMAPGEISVGDFEDYEAKLKRAKVMLRPDERAEAIWNDATNMAFSAG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VEDK LL E+ GLVEW  V MG   + +L LP E+++ ++K +QK F  R  +G + 
Sbjct: 233 LEVVEDKGLLREVAGLVEWPVVLMGEIGESFLGLPPEVLQTSMKEHQKFFSVRAPDGRIT 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+NI+ +D GA I+ GN +V+AARL DA  FW+ D                    
Sbjct: 293 -RFVTVANIETADDGATILAGNQKVLAARLSDAKFFWENDLRVAEAG------------- 338

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               ++  +  L   +V F  ++G+Q +R+ RI  L + +A  + AD  L ++A  ++KA
Sbjct: 339 ----MEPWLEALG--NVTFERRLGSQQDRIGRIATLARALAGPVGADPELAEKAARVAKA 392

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ Y+           A EEH  P GP + VPT  +S+ V+LA
Sbjct: 393 DLSSEMVYEFPELQGLMGRYYSAAAGLPDEVARACEEHYSPLGPSDAVPTAPVSVAVALA 452

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DKLDTL  FWAI+EKP+GSKDP+ALRRA LG+IR++L N + + L               
Sbjct: 453 DKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIRLVLTNDLRLSLKDIFRDSAQIVSEQL 512

Query: 530 ------EDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFFS 582
                 +  +L+ FFHDRLK++L D  IRHD+I+A+   P ND+L  +V   + L++   
Sbjct: 513 QGDITTDTDDLLAFFHDRLKVHLRDEGIRHDVIDAVTAMPGNDDLALLVARARALSDVLK 572

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           +  GE  L   +R   IL+  E  +  E S     ++   +AEK L+A + +    I ES
Sbjct: 573 TDDGENLLQGFRRANNILSQAEAADGVEYSYGADVKFAESDAEKALFAALDEAEPKIAES 632

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +      +  +  PI+ FF+ V VN D++ +R NRL+LL  I+ I L V ++ ++
Sbjct: 633 LAREDFAAAMAAMAGLRGPIDAFFEDVQVNSDNQVLRRNRLNLLSRIRQICLSVADLTRV 692


>gi|85703625|ref|ZP_01034729.1| glycyl-tRNA synthetase beta subunit [Roseovarius sp. 217]
 gi|85672553|gb|EAQ27410.1| glycyl-tRNA synthetase beta subunit [Roseovarius sp. 217]
          Length = 725

 Score =  659 bits (1699), Expect = 0.0,   Method: Composition-based stats.
 Identities = 282/748 (37%), Positives = 398/748 (53%), Gaps = 72/748 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ KAAEDL   L   L E G+ Y     + TP RL L ++GL+
Sbjct: 1   MPDLLIELFSEEIPARMQTKAAEDLRARLTEALVEAGLTYAGAAAFSTPRRLALTVQGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GPRV A +KAI+GFLR  GL         +D KKG VY A + KP R  
Sbjct: 61  GQSPTTREERKGPRVDAPEKAIEGFLRGAGLTREQLEI--RDEKKGQVYFATITKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++   +   I+  PWPKSMRW        +  W+RPL SILCIL  E  + K++DLD+
Sbjct: 119 AEIVAEELDRIIRNFPWPKSMRWGAG-----SLRWVRPLHSILCILTDEAGEVKVVDLDV 173

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T GHRF       V S D Y   L  A V+L+ E R   I  +A   A A G
Sbjct: 174 DGIRAGNSTEGHRFMGAGRFAVTSFDDYRTKLRRAHVILEAEERAQHIWQEASNQAFASG 233

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LELVED  LL E+ GLVEW  V MG  D+ +L LP E+++ ++K +QK F  +  +    
Sbjct: 234 LELVEDSGLLAEVAGLVEWPVVLMGRIDEAFLGLPPEVLQTSMKEHQKFFSVKNPKTGRI 293

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N++ +D GA I+ GN +V+AARL DA  FW+ D   +                
Sbjct: 294 ERFVTVANVETADQGATILAGNQKVLAARLSDAKFFWENDLRTVQ--------------- 338

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
            ++ L+   A L    V FH K+G+Q +R++RI  L ++IA  + AD  L ++A  ++KA
Sbjct: 339 -AQGLEGMGAGL--AHVTFHNKLGSQADRIARIAALAREIAPHVGADADLAEQAAKVAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G+ YA           A +EH  P GP + VP+  +S+ V+LA
Sbjct: 396 DLQSAMVGEFPELQGLMGRYYAAAAGLPAEVAAACQEHYSPLGPGDAVPSAPVSVAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
           DK+DTL  FWAI+EKP+GSKDPYALRRA LG+ R+++  ++ + L   +           
Sbjct: 456 DKIDTLTGFWAIDEKPTGSKDPYALRRAALGVDRLVVHGQLSVKLLDVLTGSFNRVGIAI 515

Query: 533 -------------------------------------NLILFFHDRLKLYLHDRDIRHDL 555
                                                NL+ F HDRLK++L D  IRHD+
Sbjct: 516 SETASQNKQKLGGINISGGAFQVLPEVDGRRVDARAVNLLSFLHDRLKVHLKDDGIRHDV 575

Query: 556 IEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLE 613
           I+A L    ND+L  +V     L +F  +  GE  L   KR   IL   E K+  E S  
Sbjct: 576 IDACLAMEGNDDLTLLVKRATALADFLKTDDGENLLQGFKRANNILTQAEAKDGVEYSYG 635

Query: 614 ISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVD 673
              ++   + EK L+A ++     I  ++  + +      + ++  PI+ FF  V VN +
Sbjct: 636 ADVKFAETDEEKALFAALATAEPAIAIALKSEDFAGAMGAIAALRAPIDAFFTAVQVNAE 695

Query: 674 DREVRDNRLSLLQYIKNIILIVINVQKI 701
            + +R NRL+LL  I++I L   ++ +I
Sbjct: 696 SQVIRRNRLNLLSSIRHICLQAADLTRI 723


>gi|163867855|ref|YP_001609059.1| glycyl-tRNA synthetase subunit beta [Bartonella tribocorum CIP
           105476]
 gi|161017506|emb|CAK01064.1| glycyl-tRNA synthetase beta chain [Bartonella tribocorum CIP
           105476]
          Length = 740

 Score =  659 bits (1699), Expect = 0.0,   Method: Composition-based stats.
 Identities = 337/738 (45%), Positives = 455/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPARMQ KAA +L   +   L   G+ Y+  R+YWTP RL L ++GLS
Sbjct: 1   MSDLLLELFSEEIPARMQRKAAANLKKTVTDQLVNAGLTYKAAREYWTPRRLTLDIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP   + + AIDGFLR+TGL  IS+  I  D KKGD Y+A + K  R  
Sbjct: 61  IRSKDVHEERKGPSTKSPQYAIDGFLRATGLNDISEAHIGHDDKKGDFYIAKIVKKGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E++L  I+P  I+  PWPKSMRW    +   A  WIRPL++ILCI   E  +  +I   +
Sbjct: 121 EEILADILPDIIRNFPWPKSMRWGKDSAKSGALKWIRPLQNILCIFGPEIGETHVIPFTI 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   P +V+  D Y+  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GSLESNNLTYGHRFLSDGKPFQVRRFDDYVTQLETHKVILDAERRKNIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLEL++D+ LLEE+ GLVEW  + MG FDK +L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELIQDEALLEEVAGLVEWPVILMGDFDKSFLDIPPEIIRLTIRANQKCFVTRKQGEKI 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L++ FILVSNI A+D G  I +GNS+VV ARL DAL+FW++DQ +LP++  L+ S  KF
Sbjct: 301 KLSHHFILVSNILANDEGKEISKGNSKVVRARLSDALYFWQKDQRDLPDIQQLESSIKKF 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LD+ KPLDQRMARLD L+V FHAK+GTQ  RV RI  L +KIA LI AD  L +RA +L
Sbjct: 361 DLDIKKPLDQRMARLDHLNVTFHAKLGTQSARVERIATLAQKIAPLIQADPLLANRAAIL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEIV EFPELQG +G +YA+LQ E+     AIEEH KP+GP + +P   ++IT+
Sbjct: 421 AKADLQTEIVGEFPELQGVMGHKYALLQGEDPRVAVAIEEHYKPQGPADRLPQEPLAITI 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE------- 530
            LADK+D L+ FW INEKP+GSKDPYALRRA LGIIR+IL     I L    +       
Sbjct: 481 MLADKIDMLVGFWLINEKPTGSKDPYALRRAALGIIRLILSRDWKINLMPLFQLATNLFV 540

Query: 531 ---------------------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFHDRLK+YL +   R+D +EA+L  +
Sbjct: 541 QQKNKYEISQRENPQLQNLLPETTEVILSDLLFFFHDRLKIYLKEEGARYDALEAVLNKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
           +D+ L +   ++ L  F ++  G  F+ S KR   IL  E +K+  I+ EI+P+    + 
Sbjct: 601 SDDFLLVARHVESLIAFINTHDGMNFVASVKRTANILQNELQKSTTIANEINPELFFEKE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  I +    +   ++         +L  + + I++FF++VLVN    +VR NRL+
Sbjct: 661 EKQLYHAICEVEKKVLAPINITNLSFALGILAPLGKLIDLFFEKVLVNDKKPDVRANRLA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL+    I   V +  K+
Sbjct: 721 LLKRTHTITQAVADFSKL 738


>gi|78484700|ref|YP_390625.1| glycyl-tRNA synthetase, beta subunit [Thiomicrospira crunogena
           XCL-2]
 gi|78362986|gb|ABB40951.1| glycyl-tRNA synthetase, beta subunit [Thiomicrospira crunogena
           XCL-2]
          Length = 690

 Score =  657 bits (1694), Expect = 0.0,   Method: Composition-based stats.
 Identities = 212/723 (29%), Positives = 347/723 (47%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            +FL+EI +EE+P +   K +      +   L +  + Y     Y +P RL + +  L  
Sbjct: 6   AEFLVEIGTEELPPKALKKLSNAFMDGIKAGLDDAELNYGETAVYASPRRLAVRIDALQT 65

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
              +K  ER GP         G   KA+ GF R  G       +I+   +KG   +  L 
Sbjct: 66  KQADKTVERKGPAKKAAFDAEGQPTKALQGFARGCGADVADLSEIE--TEKGIWMVYYLE 123

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
           +  +L  ++L  IV  ++ K+P PK MRW  +        ++RP+   L +L      ++
Sbjct: 124 QKGQLTAELLPAIVNQSLAKLPIPKRMRWGASD-----VEFVRPVHWALMLL-----DDQ 173

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAH 233
           ++   +      N T+GHRFHAP  I++     Y+  L+ +  V  D E R+  I     
Sbjct: 174 VVPATILGHQTSNKTHGHRFHAPQAIEICKPSEYVSVLKEQGYVQADFEERKARIREQVE 233

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
            +A + G     D DLL+E+  L EW    +G FD+ +L +P E +   +K +QK F   
Sbjct: 234 AVAQSAGGVADIDDDLLDEVTALNEWPTAVVGDFDESFLSVPSEALISAMKGHQKYFHIL 293

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
            + G L   FI +SNI++S    ++  GN RV+  RL DA  FW +D+            
Sbjct: 294 DKAGQLMAKFITISNIESS-NPESVKNGNERVIRPRLSDAKFFWNQDR------------ 340

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    +PLD  + RL    VVF  K+GT  ++V R+  L  KI + +  D  +++R
Sbjct: 341 --------KQPLDDFLPRLKT--VVFQQKLGTLYDKVERLETLVVKIGRPLGEDAQVLER 390

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A  LSK DL TE+V EFP+LQG +G+ YA  QNE++   DAI+   +PR   + +P + +
Sbjct: 391 AARLSKCDLMTEMVGEFPDLQGVMGRYYAQAQNEDVKVADAIDGQYQPRFAGDQLPDSVV 450

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           S  +++ADKLDT+   + I + P+G KDP+ALRR+ LG++RI++E ++D+ L   I    
Sbjct: 451 SQALAIADKLDTITGIYGIGQVPTGDKDPFALRRSALGLVRILIEKELDLDLQLMIRFSL 510

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                          +  F   RLK Y   + +  +  EA+      + L     I+ + 
Sbjct: 511 DLHSEIDTSEALVMEIYDFIISRLKAYYAGKGVSAEQFEAVRVCAPSHPLDFAKRIEAVC 570

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
           +F    + E    + KRI  IL    K +  +  E+       ++E+ L+  +      +
Sbjct: 571 QFSEMDEAESLSAANKRIANILK---KVDATLPEEVESSLFEEDSERDLFDALDALRETV 627

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
              +  + Y     LL +I +P++ FFD V+V  DD  V+ NRL+LL  I  +   V ++
Sbjct: 628 SNKIAERDYAGAMQLLATIRQPVDAFFDNVMVMADDEAVKLNRLALLNQIYQLFRQVADI 687

Query: 699 QKI 701
            ++
Sbjct: 688 SRL 690


>gi|319408196|emb|CBI81849.1| glycyl-tRNA synthetase beta chain [Bartonella schoenbuchensis R1]
          Length = 740

 Score =  657 bits (1694), Expect = 0.0,   Method: Composition-based stats.
 Identities = 331/738 (44%), Positives = 452/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M + LLE++SEEIPARMQ KAA DL   +   L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MSNLLLELFSEEIPARMQRKAASDLKKCVTDQLVHAGLTYKAACEYWTPRRLTLDIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP   + +  IDGFLR+TGL  IS+  I  D KKGD Y+A + K  R  
Sbjct: 61  TSSQDTHEERRGPSTKSPQHMIDGFLRATGLNNISEAHIVHDSKKGDFYVAKITKKGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PWPKSMRW    +   A  W+R L++ILC+   E  +  I+   +
Sbjct: 121 EEIIADILPDIIRNFPWPKSMRWGQDSAQTGALKWVRSLQNILCVFGPEIGETHIVPFTV 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   PI+++  D Y+  LE   V+LD E R+N IL DA  L  A 
Sbjct: 181 GFLKSNNLTYGHRFLSDGKPIQIRRFDDYVTLLEAHKVILDTERRKNIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREG-- 297
           GLELV+D  LLEE+ GLVEW  V MG FDK +L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVQDNALLEEVAGLVEWPVVLMGDFDKTFLDIPPEIIRLTIRANQKCFVTRKQGEKI 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILVSN+ A+DGG  I +GNS+VV ARL DAL+FW+ DQ++LP+++ LK+SA KF
Sbjct: 301 KLSNHFILVSNVLANDGGKEITKGNSKVVRARLSDALYFWQTDQHDLPDIAHLKDSAAKF 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A+LD L+V FHAK+GTQG RV RI  L +KIA L+ AD  L  RA +L
Sbjct: 361 DLDLNKPLDQRIAQLDYLNVTFHAKLGTQGARVERIAALAQKIAPLVQADPLLAKRAAIL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL T IV EFPELQG +G++YA+LQ E+    +AIE+H KP GP + +P   I+I V
Sbjct: 421 AKADLQTGIVAEFPELQGLMGRKYALLQGEDPHVAEAIEDHYKPLGPTDRIPCEPIAIAV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------ 531
           +LADK+D L+ FW INEKP+ SKDPYALRRA LGII+++L     I L    +       
Sbjct: 481 ALADKIDILVGFWLINEKPTSSKDPYALRRAALGIIKLVLSRDWKINLMPLFDQAVDLFL 540

Query: 532 ----------------------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ F H+RLK+YL D   R+D IEA+L  +
Sbjct: 541 QQKIKYTSPKIEAKQQQNTLSETKKDILSDLLSFLHERLKIYLKDEGARYDAIEAVLTKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D+ L +   I+ L  F ++  G  FL S KR+  IL  +  K+      ++P+      
Sbjct: 601 ADDFLLVARCIESLIVFINTNDGNDFLASVKRVVNILENQPSKDITTINTLNPELFSEIE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  I D    + +  +        + L  + +PI+ FF++VLVN  +  +R NRL+
Sbjct: 661 EKQLYQAIIDAEKKLHDQTNATNLSLALNALVPLKKPIDTFFEKVLVNDKNSAIRANRLA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL+ I+ I   V +  K+
Sbjct: 721 LLERIRLITQNVADFSKL 738


>gi|83942787|ref|ZP_00955248.1| glycyl-tRNA synthetase, beta subunit [Sulfitobacter sp. EE-36]
 gi|83846880|gb|EAP84756.1| glycyl-tRNA synthetase, beta subunit [Sulfitobacter sp. EE-36]
          Length = 706

 Score =  655 bits (1690), Expect = 0.0,   Method: Composition-based stats.
 Identities = 279/729 (38%), Positives = 409/729 (56%), Gaps = 53/729 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA+DL  ++   L + G+ Y +   + TP RL L ++G+ 
Sbjct: 1   MPDLLIELFSEEIPARMQARAADDLKKLVTNGLVDAGLTYASAAAFSTPRRLTLTVEGML 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP  +EER GP+  A +KAI+GFLR  GL    D   ++D  KG +  A++ KP R  
Sbjct: 61  DASPSLVEERKGPKADAPEKAIEGFLRGAGLT--RDQLEERDTPKGKILFAMINKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW +      +  W+RPL SILCIL AED   + + L +
Sbjct: 119 AEIVAEVLETTIRNFPWPKSMRWGSG-----SLRWVRPLHSILCILSAED-GVQTVPLTI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G+ T GHRF AP  I V S D Y   L+   V+LDP  RR+ I NDA  +A A G
Sbjct: 173 DGITAGDTTRGHRFLAPDTITVSSFDDYSAKLKRVFVVLDPAERRDTIWNDATNMAFANG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VED  LL E+ GLVE+  V MG     +L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LEVVEDAGLLAEVAGLVEYPVVLMGQIGDDFLGLPPEVLQTSMKEHQKFFSVRNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N   +D GA I+ GN +V++ARL DA  FW+ D     + + ++         
Sbjct: 293 ERFVTVANRTTADDGATILAGNEKVLSARLSDAKFFWENDLRIAQSEAGMQT-------- 344

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                   + RL   +V FH K+GTQ E +SR+  L  ++A ++ AD      A   +KA
Sbjct: 345 -------WVDRLS--NVTFHNKLGTQAELISRMEALAGELAPMVGADAEEARAAARFAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G  Y     ++ +   A ++H  P GP ++VPT ++SI V+LA
Sbjct: 396 DLSSEMVYEFPELQGLMGSYYTKAAGKSEAIAAAAQDHYAPLGPSDDVPTARVSIAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
           +K+D L  FWAI+EKP+GSKDP+ALRRA LG+IRI++EN + + L   I +         
Sbjct: 456 EKIDKLTGFWAIDEKPTGSKDPFALRRAALGVIRILVENDVSMKLRDTILEHLSQAPAPA 515

Query: 533 ---------NLILFFHDRLKLYLHDRDIRHDLIEAILRP----------ENDNLLTIVDL 573
                    NL+ F HDRLK+YL D+ +RHD+I+A +             ND+L  +V  
Sbjct: 516 AGSAEETAENLLSFLHDRLKVYLKDQGVRHDIIDACISSSDGAPAGATDGNDDLTLLVKR 575

Query: 574 IKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVIS 632
            K L+E   +  GE  +   KR   IL+  E  +R E S     ++   + E+ L+A + 
Sbjct: 576 AKALSETLKTDDGENLIQGFKRANNILSQAEDADRVEYSFGADIKFAETDEERALFAALD 635

Query: 633 DFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNII 692
                I+ +M+ + +      + S+  PI+ FFD V VN D+  VR NRL+LL  I+ I 
Sbjct: 636 TAEAQIKPAMEAQDFGTAMSAMASLRGPIDAFFDAVQVNADNATVRRNRLNLLSRIRTIC 695

Query: 693 LIVINVQKI 701
             V ++ KI
Sbjct: 696 SSVADLTKI 704


>gi|319407554|emb|CBI81204.1| glycyl-tRNA synthetase beta chain [Bartonella sp. 1-1C]
          Length = 742

 Score =  655 bits (1690), Expect = 0.0,   Method: Composition-based stats.
 Identities = 339/738 (45%), Positives = 452/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPA+MQ KAA DL   +   L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MPDLLLELFSEEIPAQMQRKAASDLKKCVTDKLINAGLTYKAACEYWTPRRLTLNIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP+  EER GP V + ++ ID FLR+TGL  IS   I  D KKG+ Y+A   K  RL 
Sbjct: 61  KSSPDVHEERKGPNVQSPQQVIDAFLRATGLNDISKVHIAHDDKKGNFYIAKTTKKGRLA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I   PWPKSMRW    +   +  WIR L++ILC+  +   + KII   +
Sbjct: 121 EEIIADILPDIIYNFPWPKSMRWGQESAKNGSLRWIRSLQNILCVFGSAIGETKIIPFTV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   PI+V+  D YI  LE   V+LD E R++ IL D   L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSNGNPIQVRRFDDYISQLENHKVILDAERRKDIILADIQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT--REG 297
           GLELVEDK LLEE+ GLVEW  V MG+FDK +L +P E+IRLTI+T+QKCFVTR    + 
Sbjct: 241 GLELVEDKALLEEVSGLVEWPVVLMGTFDKTFLSIPPEIIRLTIQTHQKCFVTRKRGEKS 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILVSNI ASD G  I +GNS+VV ARL DAL+FW+ DQ NLPN   L+ SA K 
Sbjct: 301 KLSNYFILVSNILASDKGIEISKGNSKVVHARLSDALYFWETDQCNLPNTMHLESSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A L  L+V FHAK+GTQG R+ RI  L + IA L+ AD  L  RA VL
Sbjct: 361 DLDLNKPLDQRVAHLHYLNVTFHAKLGTQGARIERIAALTQTIAPLVQADSILAKRAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEI+ EFPELQG IG++YA+LQ E+    +AIE+H +P GP + +P   I++TV
Sbjct: 421 AKADLQTEIIGEFPELQGVIGRKYALLQGEDPLVAEAIEDHYRPLGPKDRIPITPIAVTV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ----- 532
           +LADK+DTLI FW INEKP+ SKDPYALRRA LG+I++IL N + I L            
Sbjct: 481 ALADKIDTLIGFWFINEKPTSSKDPYALRRAALGVIKLILSNDLKIRLIPLFHQAINFLL 540

Query: 533 -----------------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ F H+RLK YL D   RHD+IEA+L  +
Sbjct: 541 QQRVKYAASETKGVNLQNISVEKKENIVLDLLAFLHERLKGYLKDEGARHDIIEAVLTKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D++L I   ++ L  F +S  G+  L++ KR   IL  E KK   I  ++ P+  +   
Sbjct: 601 ADDILLITRRVETLTFFINSNDGDSLLIAIKRAINILENETKKGMIIINKVKPELFIETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY    +    I + +         + L  + +PI  FF++V VN D+ ++R NRL+
Sbjct: 661 EKQLYQATLETEKKIADHIHITELSSALNSLALLKKPINAFFEKVFVNDDNIDIRANRLA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL  I+ +   V +  K+
Sbjct: 721 LLNRIRIVTQNVGDFSKL 738


>gi|254491151|ref|ZP_05104332.1| glycyl-tRNA synthetase, beta subunit [Methylophaga thiooxidans
           DMS010]
 gi|224463664|gb|EEF79932.1| glycyl-tRNA synthetase, beta subunit [Methylophaga thiooxydans
           DMS010]
          Length = 692

 Score =  655 bits (1689), Expect = 0.0,   Method: Composition-based stats.
 Identities = 229/727 (31%), Positives = 356/727 (48%), Gaps = 63/727 (8%)

Query: 1   MP---DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLK 57
           M    D L+E+ +EE+P +     ++     +    K+  +    +R Y TP RL L + 
Sbjct: 1   MSNTNDLLIELGTEELPPKALATLSKAFHQGVEQGFKKAELQCDEIRPYATPRRLALVIT 60

Query: 58  GLSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYL 110
            L     ++  ER GP V       G   KA+ GF +S G+       +K D  KG   +
Sbjct: 61  KLQTRQQDRTIERRGPAVTSAFDEDGNPTKALMGFAKSCGVDVDDLETMKTD--KGAWLV 118

Query: 111 AVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAED 170
              ++       +L  I+  A+ ++P PK MRW           ++RP+  ++ +     
Sbjct: 119 FKQQQEGADTASLLPDIIQQALNELPIPKRMRWGDL-----PGEFVRPVHWLVVLF---- 169

Query: 171 AKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAIL 229
             + ++ +DL  +  G ++ GHRFH P PI++ S   Y   LE E  VL+D + R+  I 
Sbjct: 170 -GDDVVPVDLLGVSAGRMSRGHRFHNPQPIEIGSAMTYAPQLESEGHVLVDYDARKQIIN 228

Query: 230 NDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKC 289
              + LA  +G E V + DLLEE+ GLVEW     G+FD+++L LP E +  +++ +QK 
Sbjct: 229 TQVNELAEKLGGEAVINPDLLEEVTGLVEWPVALAGNFDERFLELPAEALISSMEGHQKY 288

Query: 290 FVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSS 349
           F  R +   L   FI VSNI + D  A +V GN RV+  RL DA  FW  D+        
Sbjct: 289 FAVRAKNSDLLPHFITVSNIASQD-PAQVVAGNERVILPRLSDAAFFWDTDR-------- 339

Query: 350 LKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVA 409
                        +PL  R  +L    +VF  K+GT  ++  R+  L  +IAQ I  D A
Sbjct: 340 ------------KQPLAARQEQLK--SIVFQNKLGTVYDKSQRVAKLAAEIAQHIRGDEA 385

Query: 410 LVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
           L +RA +L+K DL TE+V EFP+LQG +G+ YA L  EN    +A++E   PR   + +P
Sbjct: 386 LAERAAMLAKCDLVTEMVGEFPDLQGIMGRYYARLDGENNDVAEALDEQYLPRFAGDQLP 445

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
                  VSLA+KLDTL   + I + P+G KDP+ALRRA LG++RII+EN++D+ L+  +
Sbjct: 446 VTPTGQAVSLAEKLDTLTGLFGIGQPPTGVKDPFALRRAALGVLRIIIENELDLDLASLV 505

Query: 530 ED---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
           +                  ++ +F+DRL+ Y  D+  + D  EA+L  +    L  +  +
Sbjct: 506 DFAADTCGDTLTEKSVTSQVMQYFYDRLRGYALDQGFKADEFEAVLAVKPSRPLDFMQRL 565

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
           K +  F    + +      KRI  IL   E +     + I    L   AEK L   ++  
Sbjct: 566 KAVAAFRQLEQADSLAAGNKRIGNILRKNEAEAE--GMTIDDALLQESAEKDLAEKLAQA 623

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
              +        Y  + + L  + E I+ FFDQV+V  DD  VR NRL++L   + + L 
Sbjct: 624 SQDLAPLSAKSDYAGVLNYLAGMRETIDAFFDQVMVMADDEAVRQNRLAILNQTRALFLG 683

Query: 695 VINVQKI 701
           V ++  +
Sbjct: 684 VADISCL 690


>gi|220936411|ref|YP_002515310.1| Glycine--tRNA ligase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997721|gb|ACL74323.1| Glycine--tRNA ligase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 696

 Score =  654 bits (1686), Expect = 0.0,   Method: Composition-based stats.
 Identities = 216/724 (29%), Positives = 350/724 (48%), Gaps = 62/724 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            D L+EI +EE+P +      +  +  +   L E G+    ++ +  P RL L  + ++ 
Sbjct: 5   HDLLIEIGTEELPPKALKGLRDAFAESVAAGLAEAGIGASKVQAFAAPRRLALLCRDVAA 64

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
             P++  ER GP +       G   KA  GF  S G++     +++ D  KG   +    
Sbjct: 65  RQPDQSMERRGPALAAAFDDNGNPTKAAQGFAASCGVKPEDLERLETD--KGAWLVHRHV 122

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
           +P +    ++ +IV  A+  +P PK MRW  + +      ++RP+  ++ +L      + 
Sbjct: 123 EPGKAAAALIPSIVERALAALPIPKRMRWGDSDA-----EFVRPVHWVVLLL-----GDA 172

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAH 233
           +++ ++  +  G  T GHRFH P  + +     Y   L+    V+ D E RR AIL    
Sbjct: 173 VVEAEILGVKAGRETRGHRFHHPDTLFIAEPAAYAPLLQTEGRVMADFEARREAILGQVE 232

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
             A  +G   + + DLL+E+  LVEW     G F+ ++L +P+E +  T++ NQK F   
Sbjct: 233 DAAQKLGGRALIEPDLLDEVTALVEWPSAIAGHFETRFLDVPQEALITTMQDNQKYFPVV 292

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
            + G L   FI VSNI++ +    + +GN RV+  R  DA  FW +D+            
Sbjct: 293 DQVGRLMPHFITVSNIESRE-PERVREGNERVIRPRFSDAEFFWNQDR------------ 339

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    KPLD  +  L    VVF  K+GT  E+  R+  L K +A L++ D     R
Sbjct: 340 --------KKPLDSHLEALK--HVVFQRKLGTLFEKTERVAALTKHLAGLLNVDHGEALR 389

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF ELQG +G+ YA    E      A+EE   PR   +N+P   +
Sbjct: 390 AAMLSKCDLQTHMVFEFTELQGTMGRYYAEHGGEPADVAQALEEQYWPRHAGDNLPETGV 449

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI---- 529
              ++LAD+LDTL+  +AI +KP+G+KDPY LRRA LG++RI++E ++D+ L   I    
Sbjct: 450 GKALALADRLDTLVGIFAIGQKPTGAKDPYGLRRAALGVLRILIERELDLDLLALIRAAA 509

Query: 530 ------------EDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHL 577
                          ++  +  +RL+ Y  DR I  D+ EA+L       L     ++ +
Sbjct: 510 EGYQGTDVNAAGAVASVFDYMMERLRAYYTDRGIGVDVFEAVLACRPLRPLDFDRRVRGV 569

Query: 578 NEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTH 637
           + F S  + +    + KRI  IL    K    +  +I P     +AE+ L+  +      
Sbjct: 570 DHFRSLPEAQSLAAAHKRIHNILK---KVEGALPEQIDPARFSEDAERALFDRLEALRGT 626

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
                   RY +    L ++ EP++ FFD V+V  DD  VRDNRL+LL  +  + L V +
Sbjct: 627 ALPLFTEGRYTEGLAALAALREPVDRFFDGVMVMADDAAVRDNRLALLNSLSGLFLEVAD 686

Query: 698 VQKI 701
           + ++
Sbjct: 687 MSRL 690


>gi|170740976|ref|YP_001769631.1| glycyl-tRNA synthetase subunit beta [Methylobacterium sp. 4-46]
 gi|238688003|sp|B0UNU2|SYGB_METS4 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|168195250|gb|ACA17197.1| glycyl-tRNA synthetase, beta subunit [Methylobacterium sp. 4-46]
          Length = 704

 Score =  652 bits (1683), Expect = 0.0,   Method: Composition-based stats.
 Identities = 310/724 (42%), Positives = 422/724 (58%), Gaps = 45/724 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ +AAEDL  ++   L E G +Y+  + + TP RL L++ GL 
Sbjct: 1   MPDLLLELFSEEIPARMQRRAAEDLRKLVTDALVERGFLYEGAKAFSTPRRLALHVAGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVGA + A+ GFL+S GL ++   ++  DPKKG+ Y+AV+ +P R  
Sbjct: 61  VRGQDVREERKGPRVGAPEAAVQGFLKSAGLASLDQARVVADPKKGEFYVAVIERPGRET 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  I+P  I+  PWPKSMRW    +   A  W+RPL +I+     E    + +   +
Sbjct: 121 LDVLAEILPAIIRAFPWPKSMRWGAASAEPGALRWVRPLHAIVATFGPETETPERVPFRV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF +P PI+V+    Y+  LE A V+LD + R++ IL+DA  LA A G
Sbjct: 181 DGIEAGFTTYGHRFLSPGPIEVRRFADYLPALERAKVVLDADRRKDIILHDARDLAFARG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR----- 295
           L+LVED+ LLEE+ GLVEW    MG+FD  +L +P E+IR TI+ NQKCFV R       
Sbjct: 241 LDLVEDEGLLEEVAGLVEWPVTLMGAFDASFLDIPPEVIRATIRANQKCFVLRAPAADPA 300

Query: 296 ---EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
                 LAN FILVSN+ ASDGGAAIV GN RVV ARL DA  FW+ D+           
Sbjct: 301 AKGRERLANAFILVSNLAASDGGAAIVAGNERVVRARLSDAKFFWETDR----------- 349

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD 412
                      PL +R+ +LD  D+VFH K+GTQ  RV RI  L +  A ++ AD A  +
Sbjct: 350 ---------KIPLAERLPKLD--DIVFHEKLGTQAARVGRIAALARAFAPVVGADPAEAE 398

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA  L+KADL TE+V EFPELQG +G+ YA LQ E  +   AIEEH KP GP + VPT  
Sbjct: 399 RAARLAKADLVTEMVGEFPELQGLMGRYYAELQGEPEAVAAAIEEHYKPLGPGDRVPTGP 458

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENK------------ 520
           +S+ V+LADKLDTL+ FW+++EKP+GSKDPYALRRA LG+IR++L               
Sbjct: 459 VSVAVALADKLDTLVGFWSVDEKPTGSKDPYALRRAALGVIRLVLGAGARLPLLPALAAA 518

Query: 521 -IDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLN 578
                 +      +L+ FF DRLK++L D+  RHDLI+A+   P  D+LL +V  ++ L 
Sbjct: 519 AGGHGAAPGGFAADLLGFFADRLKVHLRDQGARHDLIDAVFALPGQDDLLLVVRRVEALG 578

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREI-SLEISPQYLLLEAEKRLYAVISDFGTH 637
               +  G   L   +R   IL IEEKK+         P    L  E  L   ++     
Sbjct: 579 RLLDTEDGTNLLAGYRRAANILRIEEKKDGRAHDGAPDPARFALPEETALAEALAAARGA 638

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
            + ++  + +      L  +  P++ FFD+V VN +D  +R+NRL+LL  ++   L V +
Sbjct: 639 AERAVAAEDFEGAMRALAGLRAPVDAFFDKVTVNAEDPAMRENRLALLGALRTATLAVAD 698

Query: 698 VQKI 701
             +I
Sbjct: 699 FSRI 702


>gi|288959118|ref|YP_003449459.1| glycyl-tRNA synthetase beta chain [Azospirillum sp. B510]
 gi|288911426|dbj|BAI72915.1| glycyl-tRNA synthetase beta chain [Azospirillum sp. B510]
          Length = 729

 Score =  651 bits (1680), Expect = 0.0,   Method: Composition-based stats.
 Identities = 277/748 (37%), Positives = 405/748 (54%), Gaps = 77/748 (10%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           + L+E++SEEIPARMQ KAA D   +++  L   G+ +Q   +  TP R+ L + GL   
Sbjct: 8   ELLVEVFSEEIPARMQAKAALDFRRLIVEKLAAAGLGFQAAVEQSTPRRIALVVNGLPDR 67

Query: 63  SPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIED 122
           + +  EE+ GPRVG+ ++A+ GFL+S GL ++  C+ ++D  KG  Y AV  K  R   +
Sbjct: 68  TEDIKEEKKGPRVGSPEQAVAGFLKSAGLDSLDQCE-QRDTGKGVFYFAVTEKKGRETAE 126

Query: 123 VLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA-KEKIIDLDLK 181
           VL  I+P A+ ++PWPKSMRW           W+RPL SI+ +           I     
Sbjct: 127 VLAEIIPAAMAELPWPKSMRWG-----TGTARWVRPLHSIIALFGGRVLDGGYDIGGAQG 181

Query: 182 EIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGL 241
            I  G+ T GHRF AP    V+S   Y   L  A V+LD E R+  I  DA  LA++ GL
Sbjct: 182 RIAFGDSTRGHRFLAPDAFTVESFADYREKLLAAKVVLDREERKAKIKADAEALAASQGL 241

Query: 242 ELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLAN 301
            L  D  LLEE+ GLVEW  V MGS D+ ++ +P E++  +++T+QK F     EG +A 
Sbjct: 242 TLSPDDALLEEVAGLVEWPVVLMGSIDESFMDVPSEVLITSMRTHQKYFAVLDAEGRMAP 301

Query: 302 CFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDL 361
           CFI+V+N +  DGG A+V GN RV+ ARL DA  FW +D                     
Sbjct: 302 CFIVVANTETLDGGKAVVAGNERVLRARLSDAKFFWDQDH-------------------- 341

Query: 362 SKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKAD 421
              L+ R + L+   + FHA +GT  E+V+RI++L  +IA++I ADV   +RA  L KAD
Sbjct: 342 KTKLEDRKSSLE--KITFHANLGTVAEKVTRIQLLAAEIARIIGADVKAANRAAELCKAD 399

Query: 422 LCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLAD 481
           L TE+V EFPE+QG +G+ YA  Q E+    DAI +H KP GP ++ PT  +S+ V+LAD
Sbjct: 400 LVTEVVGEFPEVQGIMGRYYAKDQGESDDVADAIADHYKPVGPSDSCPTVPVSVAVALAD 459

Query: 482 KLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF------------- 528
           K+DTL+ F+AI+EKP+GSKDPYALRRA LG+IR+IL N + + L+               
Sbjct: 460 KIDTLVGFFAIDEKPTGSKDPYALRRAALGVIRLILTNDLRLRLTDITGFAFNSHYAQGR 519

Query: 529 ---------------------------------IEDQNLILFFHDRLKLYLHDRDIRHDL 555
                                                 L+ FF DRLK+ L ++ +RHDL
Sbjct: 520 IIEHEPEATGSKSLQKFGKALESIPSRREVWSDWTTDGLMSFFADRLKVVLREQGVRHDL 579

Query: 556 IEAILRPEN-DNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLE 613
           ++A+      D+L+ ++  +K L  F  S +G   L + KR   I+ IEEKK+       
Sbjct: 580 VDAVFALGGEDDLVRLLARVKALQAFVGSEEGANLLAAYKRASNIVRIEEKKDGISFDQP 639

Query: 614 ISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVD 673
           +    L  + E  L A ++      +  +D + +      L ++  P++ FFD+V VN +
Sbjct: 640 VDAARLAQDEETALSAALNGASATAKPLLDAEDFTGTMAALANLRGPVDAFFDKVTVNAE 699

Query: 674 DREVRDNRLSLLQYIKNIILIVINVQKI 701
           D+++R NRL LL  I+  +  V +  KI
Sbjct: 700 DKDLRANRLRLLTQIRTTLNAVADFSKI 727


>gi|126725590|ref|ZP_01741432.1| glycyl-tRNA synthetase beta subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126704794|gb|EBA03885.1| glycyl-tRNA synthetase beta subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 685

 Score =  650 bits (1678), Expect = 0.0,   Method: Composition-based stats.
 Identities = 272/710 (38%), Positives = 388/710 (54%), Gaps = 36/710 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ +AA DL  ++   L + G+ Y +   + TP RL L ++GL 
Sbjct: 1   MPDLLLELFSEEIPARMQTRAANDLKKLVTDGLVKSGLTYASAEAFSTPRRLTLVVEGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP  +EER GPRV A  KAI+GFLR  GL    D    +D KKG VY A + K  R  
Sbjct: 61  AESPMIVEERKGPRVDAPAKAIEGFLRGAGLT--RDQLDVRDEKKGQVYFARIEKAGRAA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
             +   ++   I+  PWPK+MRW T         W+RPL SILC+L  E A  +++  D+
Sbjct: 119 PIIAAEVITDTIRNFPWPKAMRWGTGE-----LRWVRPLHSILCVLSDE-AGSEVVPFDV 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   N T GHRF       V   D Y   L +  V+L    R + I  DA   A A G
Sbjct: 173 DGIAANNTTEGHRFMGTGRFSVTDFDDYATKLRQNHVILRATDRADHIWADATNQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V+DK LL E+ GLVEW  V MG+ D  +L LP E+++ ++K +QK F  +  +    
Sbjct: 233 LEVVDDKGLLTEVAGLVEWPVVLMGAIDDDFLDLPPEVLQTSMKEHQKFFSVKNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N    D GA I+ GN +V++ARL DA  FW+ D                    
Sbjct: 293 EKFITVANRDTKDNGATILAGNQKVLSARLADAKFFWENDLRVA---------------- 336

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               +   +  L+  +V FH K+GTQ  R+ RI  L ++IA ++ AD  + + A  ++KA
Sbjct: 337 -KSDIGSWVKSLE--NVTFHNKLGTQSARIDRIATLAREIAPMVGADAEVAENAARVAKA 393

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA     +     + +EH  P GP ++VP+N +S+ V+LA
Sbjct: 394 DLSSEMVYEFPELQGLMGRYYATAAGMSDDIALSAQEHYSPLGPSDDVPSNPVSVAVALA 453

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-------QN 533
           DK+DTL  FWAI+EKP+GSKDP+ALRRA LG+IR+ L+N + + L             ++
Sbjct: 454 DKIDTLTGFWAIDEKPTGSKDPFALRRAALGVIRLTLDNDLSMNLKSVFARGYENANAED 513

Query: 534 LILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFFSSAKGEKFLLS 592
           L+ FFHDRLK YL D+ IRHD+I+A L    ND+L  +V     L +   +  GE  L  
Sbjct: 514 LLSFFHDRLKTYLRDQGIRHDVIDACLAMANNDDLSLLVKRATALADLLKTDDGENLLQG 573

Query: 593 AKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIG 651
            KR   IL   E K+          ++   +AEK L+A +      I+ ++    +    
Sbjct: 574 YKRANNILTQAETKDGVSYEYGADIKFAEDDAEKALFAALDTADAAIKPALVADDFAAAM 633

Query: 652 DLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + ++  PI+ FF+ V VN D+  VR NRL+LL  I+ I     ++ ++
Sbjct: 634 SAMAALRAPIDGFFEAVQVNSDNEIVRRNRLNLLHRIRAICTSTADLSRV 683


>gi|146339077|ref|YP_001204125.1| glycyl-tRNA synthetase subunit beta [Bradyrhizobium sp. ORS278]
 gi|146191883|emb|CAL75888.1| glycine tRNA synthetase, beta subunit [Bradyrhizobium sp. ORS278]
          Length = 772

 Score =  650 bits (1676), Expect = 0.0,   Method: Composition-based stats.
 Identities = 311/792 (39%), Positives = 429/792 (54%), Gaps = 113/792 (14%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA+DL  ++   L  EG++Y+  + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQAKAADDLRRMVTDKLVAEGLVYEGAKAFATPRRLALTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVG    AI GFL++TGL ++ +  I++DPKKGD Y+A++ KP R  
Sbjct: 61  ARQADLKEERKGPRVGGPDAAIQGFLKATGLASLEEATIQRDPKKGDFYVALIEKPGRAT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            DVL  ++PV ++  PWPKSMRW        A SW+RPL +I      E  +  +I   +
Sbjct: 121 LDVLAEMLPVIVRTFPWPKSMRWGQRSEKPGALSWVRPLHAITATFGLETEEPDVISFAV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF AP    V+  + Y   L +A V+LDP+ R++ I+ DA +LA A G
Sbjct: 181 DGIEAGQTTYGHRFLAPSAFTVRRFEDYEAKLLDAKVVLDPQRRKDTIVTDAKQLAFAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
            ELVED  LL+E+ GLVEW  V MGSFD +YL +P E+IR TI+ NQKCFV R  + G L
Sbjct: 241 YELVEDPVLLDEVAGLVEWPVVLMGSFDPEYLKVPGEVIRATIRNNQKCFVVRDPKTGGL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           A  FIL +NI+A+DGG  I+ GN RV+ ARL DA  F++ D                   
Sbjct: 301 APKFILTANIEATDGGKTIIAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + +   +VFH K+GTQ  R++RI  L  +IA ++ AD A   RA  L+K
Sbjct: 342 -LKTKLEDRLPKFEQ--IVFHEKLGTQAARIARIEKLAAEIAPMVGADAAKTARAAKLAK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPE+QG +GK YA+ Q E+ S   A EEH KP+GP + VP + +S+ V+L
Sbjct: 399 ADLLTEVVGEFPEVQGLMGKYYALAQGEDASVAAACEEHYKPQGPGDRVPADPVSVAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI---------- 529
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IRIILEN + + L+             
Sbjct: 459 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRIILENDLRVHLADICGPAFFDLATA 518

Query: 530 ----------------------------------------EDQNLILFFHDRLKLYLHDR 549
                                                   +  +LI FF DRLK+ L ++
Sbjct: 519 IRAREVGNEVEQAESGEKPGLTRFVVRVDAQTFGTRSVPVKVVDLISFFADRLKVQLREQ 578

Query: 550 DIRHDLIEAILRPEN---------------------------------------DNLLTI 570
             RHDL++A+                                            D+LL +
Sbjct: 579 GARHDLVDAVFATSPSPWWRSDAARSGAGRLDLIEAAGSEEALDREPSQEEEMKDDLLMV 638

Query: 571 VDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYA 629
           V  ++ L +F  S  G+  L   KR   ILAIEEKK++ +           L+ EK L  
Sbjct: 639 VRRVEALGKFLDSDDGKNLLAGTKRASNILAIEEKKDKRKFDGAPDAALYKLDEEKALAR 698

Query: 630 VISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIK 689
            I + G     ++  + +      +  +   ++ FFD+V VN DD  +R+NRL LL  I+
Sbjct: 699 AIGEVGAEAGAAVAKEDFAAAMRAMAKLRPAVDAFFDKVKVNDDDAAIRENRLKLLNEIR 758

Query: 690 NIILIVINVQKI 701
           +    V +  KI
Sbjct: 759 SATRAVADFSKI 770


>gi|154247257|ref|YP_001418215.1| glycyl-tRNA synthetase, beta subunit [Xanthobacter autotrophicus
           Py2]
 gi|154161342|gb|ABS68558.1| glycyl-tRNA synthetase, beta subunit [Xanthobacter autotrophicus
           Py2]
          Length = 733

 Score =  650 bits (1676), Expect = 0.0,   Method: Composition-based stats.
 Identities = 299/758 (39%), Positives = 421/758 (55%), Gaps = 84/758 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA+ L  ++   L E G++Y+  + + TP RL L + GL 
Sbjct: 1   MPDLLIELFSEEIPARMQAQAADGLKKLVTDALVERGLLYEGAKAFVTPRRLALAVHGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               ++ EE+ GPRVGA   AI GFL+S GL ++    ++ DPKKGD Y+AV+ KP R  
Sbjct: 61  GRQADQREEKKGPRVGAPDGAIAGFLKSAGLSSLDQATVQSDPKKGDFYVAVVEKPGRPT 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +V+  I+P  I+  PWPKSMRW +      +  W+RPL SI+    AE  + +++  ++
Sbjct: 121 PEVIAEIIPAIIRSFPWPKSMRWGS-----GSLRWVRPLHSIVATFGAEGDEPEVVRFEV 175

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I   NITYGHRF AP PI V+ LD ++  LE A V++D + R++ IL DA   A A  
Sbjct: 176 DGIVSSNITYGHRFLAPAPITVKRLDDWMAKLEAAKVVVDRDRRKDIILADAKNEAFANR 235

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
           LELVED+ LL+E+ GLVEW  V MG+F++++L +P+E+IR TI+ NQKCFV +    G L
Sbjct: 236 LELVEDEGLLDEVAGLVEWPVVLMGAFEERFLDIPDEVIRATIRANQKCFVLKDPATGRL 295

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN F+L+SN+ ASDGGAAIV GN RV+ ARL DA  FW  D+ N                
Sbjct: 296 ANRFLLISNLVASDGGAAIVAGNERVIRARLSDAKFFWDTDRVNG--------------- 340

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
                L+ RM R     + FH K+G+Q ER+ RIR L  +IA  + A  AL + A +  K
Sbjct: 341 -----LESRMPR--FQSITFHEKLGSQAERIERIRRLAVEIAPKVGAPAALAEDAALFCK 393

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPELQG +G  YA  +        A EEH KP+GP + VPT  +S+ V+L
Sbjct: 394 ADLLTEVVGEFPELQGLMGHYYAQGEGLAPEVAAACEEHYKPQGPGDRVPTAPVSVAVAL 453

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ------- 532
           ADK+DTL+ FWAI+EKP+GSKDPYALRRA LG+IRI+LEN + + L+             
Sbjct: 454 ADKIDTLVGFWAIDEKPTGSKDPYALRRAALGVIRIVLENGLRLRLADVFTGHFKLADQD 513

Query: 533 ---------------------------NLILF----FHDR----------------LKLY 545
                                      ++ ++    F DR                LK++
Sbjct: 514 IIRTANEARIKRVEDALGDQGGAVVGNDVAMWVSRKFGDRTADSRSIDLLSFFADRLKVH 573

Query: 546 LHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEE 604
           L +   RHDL++A+      D+L  +V+ +  L  F  +  G   L   +R   IL IEE
Sbjct: 574 LREHGARHDLVDAVFALEGQDDLFLLVERMTALARFLDTEDGRTLLAGYRRAVNILRIEE 633

Query: 605 KKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEI 663
           KK+    +       L   AE+RL   I      +  ++  + +      L  +  P++ 
Sbjct: 634 KKDGRAFAGPTDATLLKEPAEERLADAIEQVKGRVAAAVAAEDFETAMTALADLRGPVDA 693

Query: 664 FFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           FFD V VN  D  +R+NRL LL  I+     + +  +I
Sbjct: 694 FFDAVTVNDQDPALRENRLKLLDEIRAATRGIADFDRI 731


>gi|307941588|ref|ZP_07656943.1| glycyl-tRNA synthetase, beta subunit [Roseibium sp. TrichSKD4]
 gi|307775196|gb|EFO34402.1| glycyl-tRNA synthetase, beta subunit [Roseibium sp. TrichSKD4]
          Length = 697

 Score =  649 bits (1674), Expect = 0.0,   Method: Composition-based stats.
 Identities = 307/722 (42%), Positives = 432/722 (59%), Gaps = 48/722 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE +SEEIPARMQ +AAEDL  ++   L + G+ Y+  + Y+TP RL L++ G+ 
Sbjct: 1   MPDLLLEFFSEEIPARMQRRAAEDLKSLVTNALVDAGLPYEGAKAYFTPRRLALHVAGVP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPRVGA +KA++GFLR  GL +I +  ++ DPKKGD Y+AV+ KP R  
Sbjct: 61  AGSAATREERKGPRVGAPEKAVEGFLRGAGLSSIDEVSVQTDPKKGDFYVAVIEKPGRDA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           +D++   +P  ++  PWPKSM+W +      +  W+RPL SI+     E  + +II+ ++
Sbjct: 121 KDIIAGFMPGIVRNFPWPKSMKWGS-----GSMRWVRPLHSIIATFGPETEEPEIIEFEV 175

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T GHRF     + V+ +D Y   LE+  V+LD + R++ ILNDA   A A+G
Sbjct: 176 DGITSGNTTRGHRFLGDEVLTVRRMDDYAAQLEKHKVVLDADRRKDIILNDAKDRALALG 235

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGVL 299
           LELVED  LLEE+ GLVEW  V  GSFD+K+L +P+E  RLTI+ NQKCFV +  + G L
Sbjct: 236 LELVEDLGLLEEVAGLVEWPVVLTGSFDEKFLEIPDECTRLTIRVNQKCFVMKDPKTGKL 295

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           A  FILVSNI + D G  IV GN +V+ ARL DA  FW+ D                   
Sbjct: 296 AKKFILVSNITSPDDGKLIVAGNEKVIRARLSDAWFFWETD------------------- 336

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L   + +LD   +VFH K+GTQGERV R+  L  ++A ++ AD     RA  L+K
Sbjct: 337 -LKTQLADNLPKLD--SIVFHEKLGTQGERVKRLEALASELAPIVGADKDKAVRAARLAK 393

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL +++V EFPELQG +G+ YA  Q E+ S   AIE+H +P+GP ++VPT+ +++ V+L
Sbjct: 394 ADLVSQMVYEFPELQGLMGRTYASKQGEDESVAIAIEDHYRPQGPSDSVPTDPVAVAVAL 453

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--------- 530
           ADKLD L  FWAI+EKP+GSKDP+ALRRA LG+IRI+LENK+ +PL+Q ++         
Sbjct: 454 ADKLDLLAGFWAIDEKPTGSKDPFALRRAALGVIRIVLENKLRLPLAQQLKASLYKIKPD 513

Query: 531 ---------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEF 580
                      +L+ FF DRLK++L D   RHDLI+A+      D+LL +V  ++ L  F
Sbjct: 514 LNNEAAEELVTDLLSFFADRLKVHLKDEGARHDLIDAVFALGGQDDLLMVVKRVEALGAF 573

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
            SS  G       KR   IL  EEKK+   +        L  +AE  L A I       +
Sbjct: 574 VSSYDGANLAAGYKRAVNILRAEEKKDGAPVEGRPHADLLQEQAEIDLAAAIDTARAAAE 633

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            ++ ++ + +    L  +  P++ FF+ +LVN DD  +R NRL LL  I++   +V +  
Sbjct: 634 NAVANEDFEEAMAALSKLRAPVDKFFEDILVNADDPALRKNRLQLLAEIRDATHVVADFS 693

Query: 700 KI 701
           K+
Sbjct: 694 KV 695


>gi|119383292|ref|YP_914348.1| glycine--tRNA ligase [Paracoccus denitrificans PD1222]
 gi|229558567|sp|A1AZF8|SYGB_PARDP RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|119373059|gb|ABL68652.1| glycyl-tRNA synthetase beta chain [Paracoccus denitrificans PD1222]
          Length = 685

 Score =  647 bits (1669), Expect = 0.0,   Method: Composition-based stats.
 Identities = 271/710 (38%), Positives = 407/710 (57%), Gaps = 36/710 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +A  DL  ++   L E G+ Y++   + TP RL L ++GL+
Sbjct: 1   MPDLLIELFSEEIPARMQARARGDLKKLVTDGLVEAGLTYKSAGAFSTPRRLALAIEGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GPR  A + A++GFLRSTGL         +D KKG V+ AV+ KP R  
Sbjct: 61  AQSPTTREERKGPRTDAPEAALEGFLRSTGLTREQLE--ARDDKKGQVWFAVVTKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++  AI+  PWPKSMRW +      +  W+RPL SI+C+L  E     ++ L++
Sbjct: 119 AEIVAEVLERAIRDFPWPKSMRWGSG-----SLRWVRPLHSIICLLSDES-GASVVPLEI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
           + I  GN T GHRF AP  I V   + Y   L  A V+LD   R  AI  +A  LA A G
Sbjct: 173 EGIGAGNTTRGHRFMAPDEIAVSGFEDYAAKLRRARVMLDAAEREAAIRQEAANLAFARG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
            E+V D+ LL E+ GLVEW    MG+ + ++L LP E+++ ++K +QK F  R  +    
Sbjct: 233 WEIVPDEGLLSEVAGLVEWPVPLMGAIEDRFLALPPEVLQTSMKEHQKFFSARNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+NI+  D G  I++GN RV+AARL DA  FW+ D                   +
Sbjct: 293 EGFVTVANIETPDHGETILKGNQRVLAARLSDAAFFWENDLR-----------------E 335

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               +      L    V F +K+G+Q +R++RI  L  +IA L+ AD    ++A  ++K 
Sbjct: 336 AKAGMADWAEGLR--SVTFQSKLGSQADRIARIAALALEIAPLVGADADQAEQAARIAKL 393

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G+ YA+         DA  +H  P GP + VP+  +S+ V+LA
Sbjct: 394 DLRSAMVGEFPELQGIMGRYYALEAGLPEPVADAARDHYSPLGPSDAVPSAPVSVAVALA 453

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-------EDQN 533
           DKLDTL  FWAI+EKP+GSKDP+ALRRA LG+IR++L N +   L Q         +  +
Sbjct: 454 DKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIRLLLVNGVRANLGQTFAKARPDADAAD 513

Query: 534 LILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFFSSAKGEKFLLS 592
           L+ FFHDRLK++L D+ +RHD+I+A+L  P ND+L+ +V+    L++   +  G   L  
Sbjct: 514 LLAFFHDRLKVHLRDQGVRHDIIDAVLSMPGNDDLVLLVNRATALSDVLKTEDGTNLLQG 573

Query: 593 AKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIG 651
            KR   ILA  E+ +  E S    P++   + E+ L+A +      I+E++  + +    
Sbjct: 574 LKRAGNILAQAEEMDGVEYSFGADPKFAETDEERTLFAALDKAEPAIREAVRLEDFQAAT 633

Query: 652 DLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + S+  PI+ FF+ V +N D++ +R NRL+LL  I++   ++ +  +I
Sbjct: 634 QGIASLRAPIDAFFEAVQINSDNQILRRNRLNLLSRIRDAGRLIADFGRI 683


>gi|319404561|emb|CBI78167.1| glycyl-tRNA synthetase beta chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 742

 Score =  646 bits (1667), Expect = 0.0,   Method: Composition-based stats.
 Identities = 343/738 (46%), Positives = 455/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPA+MQHKAA DL   +   L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MPDLLLELFSEEIPAQMQHKAASDLKKCVTDKLINAGLTYKAACEYWTPRRLTLNIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP+  EER GP V + ++ ID FLR+TGL  IS   I  D KKG+ Y+A   K  RL 
Sbjct: 61  KSSPDVHEERKGPNVQSPQQVIDAFLRATGLNDISKVHIAHDDKKGNFYIAKTTKKGRLA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I   PWPKSMRW    +   +  WIR L++ILC+L +   + KII   +
Sbjct: 121 EEIIADILPDIIYNFPWPKSMRWGQESAKNGSLRWIRSLQNILCVLGSAIGETKIIPFTV 180

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   PI+V+  D Y+  LE   V+LD E R++ IL D   L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSNGKPIQVRRFDDYVSQLENHKVILDAERRKDIILADIQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT--REG 297
           GLELVEDK LLEE+ GLVEW  V MG+FDK +L +P E+IRLTI+T+QKCFVTR    + 
Sbjct: 241 GLELVEDKALLEEVSGLVEWPVVLMGTFDKTFLSIPPEIIRLTIQTHQKCFVTRKRGEKS 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILV+NI ASD G  I +GNS+VV ARL DAL+FW+ DQ NLPN   L+ SA K 
Sbjct: 301 KLSNYFILVANILASDKGIEISKGNSKVVHARLSDALYFWETDQCNLPNTIHLESSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A LD L+V FHAK+GTQG R+ RI  L + IA L+ AD  L  RA VL
Sbjct: 361 DLDLNKPLDQRVAHLDYLNVTFHAKLGTQGARIERIAALTQIIAPLVQADSILAKRAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEI+ EFPELQG IG++YA+LQ EN    +AIE+H KP GP + +PT  I++TV
Sbjct: 421 AKADLQTEIIGEFPELQGLIGRKYALLQGENPLVAEAIEDHYKPLGPKDRIPTESIAVTV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ----- 532
           +LADK+DTLI FW INEK + SKDPYALRRA LG+I+++L N + I L            
Sbjct: 481 ALADKIDTLIGFWFINEKATSSKDPYALRRAALGVIKLMLSNDLKIRLIPLFYQAMNFLL 540

Query: 533 -----------------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFH+RLK YL D   RHD+IEA+L  +
Sbjct: 541 QQRVKYATSETESAHLQNMPVEKKENIVLDLLAFFHERLKGYLKDEGARHDIIEAVLTKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
            D++L I   ++ L  F +S  G+  L++ KR   IL  E KK   I  +I P+  +   
Sbjct: 601 ADDILLITRRVEALTFFINSNDGDSLLIAIKRAINILENETKKGTIIINKIKPELFIETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY  + +    I   +         + L  + +PI  FF++V VN D+  +R NRL+
Sbjct: 661 EKQLYQAMLETEKKIANHIHITELSSALNSLALLKKPINAFFEKVFVNDDNINIRANRLA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL  I+ +   V +  K+
Sbjct: 721 LLDRIRIVTQNVGDFSKL 738


>gi|319775140|ref|YP_004137628.1| glycine tRNA synthetase subunit beta [Haemophilus influenzae F3047]
 gi|329122944|ref|ZP_08251515.1| glycyl-tRNA synthetase beta subunit [Haemophilus aegyptius ATCC
           11116]
 gi|317449731|emb|CBY85938.1| glycine tRNA synthetase, beta subunit [Haemophilus influenzae
           F3047]
 gi|327471875|gb|EGF17315.1| glycyl-tRNA synthetase beta subunit [Haemophilus aegyptius ATCC
           11116]
          Length = 688

 Score =  645 bits (1665), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 346/720 (48%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++ +L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEEHFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIEVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L +     + +AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTV----CVEQAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|239831279|ref|ZP_04679608.1| glycyl-tRNA synthetase, beta subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239823546|gb|EEQ95114.1| glycyl-tRNA synthetase, beta subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 765

 Score =  645 bits (1665), Expect = 0.0,   Method: Composition-based stats.
 Identities = 335/762 (43%), Positives = 443/762 (58%), Gaps = 61/762 (8%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L E G+ Y+    YWTP RL L ++GL+
Sbjct: 2   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVEAGLTYEAATAYWTPRRLALDIRGLT 61

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  
Sbjct: 62  VRSKDVHEDIKGPSVTAPEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAA 121

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  +VP  I+  PWPKSMRW    +   +  W+RPL+SILC    E  +  +ID D+
Sbjct: 122 EEIVAELVPHTIRNFPWPKSMRWGAASAKPGSLRWVRPLQSILCTFGPETEETVVIDFDV 181

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +    IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 182 DGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 241

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EG 297
           GLELVED+ LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 242 GLELVEDEGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGETE 301

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILVSNI A DGG  I  GN +VV ARL DAL+FW  DQ++LP+L  L  SA KF
Sbjct: 302 ALSNKFILVSNIAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAQKF 361

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
            LDL KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+ AD  L  RA VL
Sbjct: 362 GLDLKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLVSADPKLATRAAVL 421

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TE+V EFPELQG +G++YA+LQ E  +   AIEEH KP+GP + VP N +S+ V
Sbjct: 422 AKADLQTEVVGEFPELQGAMGRKYALLQGEGETVAAAIEEHYKPQGPSDVVPKNPVSVAV 481

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-------- 529
           +LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   PL            
Sbjct: 482 ALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALK 541

Query: 530 --EDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPEND---------------NLLTIV- 571
             + Q  +  F  RL             ++  L                    +LL+ + 
Sbjct: 542 EGQVQRKLREFEARLAAENSGDVDGEQDVDNALASYEKLARAEAEASSEPVLGDLLSFLH 601

Query: 572 -----------DLIKHLNEFF---------------------SSAKGEKFLLSAKRIFQI 599
                           ++                        +   G+  L   KR   I
Sbjct: 602 DRFKVHLKDEGARYDAIDAVLSPEADNLLLVARRLEALIVFINEEDGKNLLAGTKRAANI 661

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK  +++  + P  L    EK L+  +S      + ++  + ++     L  +  
Sbjct: 662 LAAEEKKGTKVADHVDPALLREAEEKALFEAVSLASKDAEAAIAREDFNGAMLALAKLRG 721

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF++VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 722 PVDTFFEKVLVNDEDENVRANRLALLDQIRAATGKVADFSKI 763


>gi|99082150|ref|YP_614304.1| glycyl-tRNA synthetase subunit beta [Ruegeria sp. TM1040]
 gi|123252189|sp|Q1GE74|SYGB_SILST RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|99038430|gb|ABF65042.1| Glycine--tRNA ligase [Ruegeria sp. TM1040]
          Length = 687

 Score =  645 bits (1664), Expect = 0.0,   Method: Composition-based stats.
 Identities = 279/710 (39%), Positives = 408/710 (57%), Gaps = 34/710 (4%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D L+E++SEEIPARMQ +A EDL   +   L E G+ Y       TP RL L ++GL 
Sbjct: 1   MADLLIELFSEEIPARMQARAGEDLKKRMTDGLVEAGLTYAGAHALTTPRRLTLAIEGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
            HSP   EER GP+VGA +KAI+GFLR  GL    D   ++D  KG VY A + KP R  
Sbjct: 61  DHSPTVREERKGPKVGAPEKAIEGFLRGAGLT--RDQLEERDTPKGAVYFATIEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        A  W+RPL SILC+L  E    +++ L++
Sbjct: 119 AEIIAEVLEDTIRNFPWPKSMRWGAG-----ALRWVRPLHSILCLLTRE-EGSEVVPLEI 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  G+ T GHRF AP    V   + Y   L+ A V+LDP+ R  AI  DA   A A G
Sbjct: 173 DGVTSGDSTAGHRFMAPARFAVTGFEDYAAKLKRAFVVLDPKEREAAIWQDATNQAFASG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V+DK LL E+ GLVEW  V MGS D ++L LP E+++ ++K +QK F  +  +    
Sbjct: 233 LEVVDDKGLLAEVAGLVEWPVVLMGSIDAEFLDLPPEVLQTSMKEHQKFFSVKNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N + +D GA I+ GN +V++ARL DA  FW+ D     +   +          
Sbjct: 293 EKFITVANRETADNGATILAGNQKVLSARLADAKFFWENDLRIAKSEVGV---------- 342

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                +  +  L   +V FH K+GTQ  R+ RI  L ++IA ++ AD  L ++A  ++KA
Sbjct: 343 -----EGWLESLG--NVTFHNKLGTQAARIDRIAALAREIAPVVGADADLAEQAAKVAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA          +A E H  P GP ++VPT  +S+ V+LA
Sbjct: 396 DLSSEMVYEFPELQGLMGRYYAQAAGLPQEVANACELHYSPLGPSDDVPTEPVSVAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-------EDQN 533
           DK+DTL  FWAI+EKP+GSKDPYALRRA LG+IR++L N + + L +         +  +
Sbjct: 456 DKIDTLTGFWAIDEKPTGSKDPYALRRAALGVIRLVLSNDVRVGLKEVFAKAYEGADGSD 515

Query: 534 LILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLS 592
           L+ FFHDRLK++L D+ IRHD+I+A +    +D+L  +V   + L +F  S  GE  L  
Sbjct: 516 LLSFFHDRLKVFLRDQGIRHDVIDACIAMEGSDDLTLLVKRARALEDFMKSEDGENLLQG 575

Query: 593 AKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIG 651
            KR   IL+  E+K+  E S     +++   AE  L+  ++     I  +++ + +    
Sbjct: 576 FKRANNILSQAEEKDGVEYSFGADKKFVEDPAEAALFEALAANEAAISTAIEAEDFAAAM 635

Query: 652 DLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             + ++  P++ FF+ V VN D+  VR NRL+LL  I+ +   V ++ +I
Sbjct: 636 GGMAALRAPVDAFFEAVQVNSDNPVVRRNRLNLLSQIRKVCGQVADLSRI 685


>gi|114797868|ref|YP_759414.1| glycyl-tRNA synthetase subunit beta [Hyphomonas neptunium ATCC
           15444]
 gi|123028308|sp|Q0C4C9|SYGB_HYPNA RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|114738042|gb|ABI76167.1| glycyl-tRNA synthetase, beta subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 706

 Score =  645 bits (1664), Expect = 0.0,   Method: Composition-based stats.
 Identities = 284/736 (38%), Positives = 409/736 (55%), Gaps = 67/736 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D L+E++SEEIPARMQ KA  DL   L G LKE G+ ++       P RL   ++GL 
Sbjct: 1   MADLLIELFSEEIPARMQAKAEADLLAALTGKLKEAGLAWKTAFAVSGPRRLTAVVEGLD 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE+ GP+VGA ++AI GFLR  GL  IS+  +  DPKKGD Y+A    P R  
Sbjct: 61  ARSADVREEKKGPKVGAPEQAIAGFLRGAGLTDISEASVVSDPKKGDFYVAYSTVPGRDA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           +DV+   VP  I+   WPKSMRW T         W+RPL+ I+C+L        ++  ++
Sbjct: 121 KDVIAEAVPAIIRDFHWPKSMRWGTGE-----LRWVRPLQRIVCVL-----DGAVVPFEV 170

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN T GHR H   P  V     Y   LE +  V+L  + RR AIL    +  +  
Sbjct: 171 GGITSGNETEGHRVHGRGPYTVTGWADYKSQLEGQGHVVLSRDDRRAAILGGIEKACAKA 230

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT-REGV 298
           GL+ +EDK LLEE+ GL EW  V +G  D  +L LP E+I L+++T+QK F     + G 
Sbjct: 231 GLQWIEDKGLLEEVTGLAEWPVVVLGQMDPDFLDLPPEVITLSMRTHQKYFAATHAKTGK 290

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           LA  FILV+NI A+DGGA I +GN+RV++ARL DA  FW++D+                 
Sbjct: 291 LAPNFILVANIAATDGGAKIAEGNARVLSARLSDARFFWEKDK----------------- 333

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
              + PL+    +L    + F  ++G+ G++V R+  L +++A  + AD  L +RA  L+
Sbjct: 334 ---ATPLEVMGEKLKT--IAFKEELGSLGDKVERVAALARELAPAVGADPGLAERAARLA 388

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           KADL +E+V EFPELQG +G+ YA+   E+    DAI +H KP+GP ++VPT+ +SI V+
Sbjct: 389 KADLVSEMVGEFPELQGVMGRYYALAVGEDARVADAIRDHYKPQGPSDSVPTDPVSIAVA 448

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS------------ 526
           LADKLDTL+ FWAI+EKP+GSKDP+ALRRA LG++RI LEN + + LS            
Sbjct: 449 LADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVVRINLENGVRLKLSNAILKAPLAVRP 508

Query: 527 ------------------QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLL 568
                               + D  L+ FF DRLK  L D+  RHDLI+A+     D+L+
Sbjct: 509 VVKGGQSDSVRSAASKAIDALIDPTLLSFFADRLKQVLRDQGKRHDLIDAVFALGEDDLV 568

Query: 569 TIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISL-EISPQYLLL--EAEK 625
            IV  ++ L  F ++  G   L   +R   IL  EEKK        + P  +     AE+
Sbjct: 569 LIVKRVEALAAFLATEDGATLLAGYRRAANILKAEEKKGALPDGLSVDPALIAKGPAAEQ 628

Query: 626 RLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLL 685
            L+A +++    ++  +  + +      L  +  P++ FF+ VLVN  D +VR+NRL+LL
Sbjct: 629 ALWASLNETTAALEAPLKTEDFAGAMTALAGLRAPVDAFFEDVLVNDSDAKVRENRLALL 688

Query: 686 QYIKNIILIVINVQKI 701
             ++  +  V +  +I
Sbjct: 689 IAVRGALHKVADFSRI 704


>gi|16272861|ref|NP_439084.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae Rd
           KW20]
 gi|260580013|ref|ZP_05847843.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae RdAW]
 gi|1174512|sp|P43822|SYGB_HAEIN RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|1573946|gb|AAC22584.1| glycyl-tRNA synthetase, beta chain (glyS) [Haemophilus influenzae
           Rd KW20]
 gi|260093297|gb|EEW77230.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae RdAW]
          Length = 688

 Score =  645 bits (1663), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 342/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLIHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFYIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++ +L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEEHFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA       EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKAGAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|301154902|emb|CBW14365.1| glycine tRNA synthetase, beta subunit [Haemophilus parainfluenzae
           T3T1]
          Length = 688

 Score =  644 bits (1661), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/722 (29%), Positives = 346/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVDQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNGIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALSEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAKGDYTAVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|325577405|ref|ZP_08147812.1| glycyl-tRNA synthetase beta subunit [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160634|gb|EGC72757.1| glycyl-tRNA synthetase beta subunit [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 688

 Score =  644 bits (1660), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/722 (29%), Positives = 347/722 (48%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVDQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R++RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLSRLET--VLFQQQLGTLKDKTDRIEKLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFADKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAKGDYTAVLDKLANLRAPVDNFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|152972429|ref|YP_001337575.1| glycyl-tRNA synthetase subunit beta [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238897022|ref|YP_002921768.1| glycyl-tRNA synthetase subunit beta [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040630|ref|ZP_06013868.1| glycyl-tRNA synthetase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|166227916|sp|A6TFH4|SYGB_KLEP7 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|150957278|gb|ABR79308.1| glycyl-tRNA synthetase beta subunit [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238549350|dbj|BAH65701.1| glycyl-tRNA synthetase beta subunit [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259041994|gb|EEW43027.1| glycyl-tRNA synthetase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 689

 Score =  644 bits (1660), Expect = 0.0,   Method: Composition-based stats.
 Identities = 208/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSENTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMIASSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  IP   +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIPSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAQEAARKIGGQADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +D+ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLDLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGEKLTNANVVDDVIDFMLGRFRAWYQDEGYGVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K +  ++  +    L   AE +L   +    
Sbjct: 566 AVSHFRTLEESSALAAANKRVSNILA---KSDETLNDIVHASVLKEAAEIKLAGNLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY      L ++ EP++ FF+ V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFAAGRYQDALIELAALREPVDEFFENVMVNAEDKDVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|301169648|emb|CBW29249.1| glycine tRNA synthetase, beta subunit [Haemophilus influenzae
           10810]
          Length = 688

 Score =  644 bits (1660), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 346/720 (48%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEMEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLIHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLEVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIEVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L +     + +AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTV----CVEQAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|190151158|ref|YP_001969683.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264507|ref|ZP_07546092.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|238692361|sp|B3GZ55|SYGB_ACTP7 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|189916289|gb|ACE62541.1| Glycyl-tRNA synthetase beta chain [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870204|gb|EFN01963.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 688

 Score =  643 bits (1659), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/722 (28%), Positives = 345/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVDDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +        E++P   +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKAD----VAIGEVNPTACVEPAEKALAEAVLGLRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L S+ +P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAKGEYTAVLDKLASLRQPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|148828101|ref|YP_001292854.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae PittGG]
 gi|166227915|sp|A5UI65|SYGB_HAEIG RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|148719343|gb|ABR00471.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittGG]
          Length = 688

 Score =  643 bits (1659), Expect = 0.0,   Method: Composition-based stats.
 Identities = 208/720 (28%), Positives = 345/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLAKQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L +   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLRDKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGRLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I  D A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGTDEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIEVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L +     + +AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTV----CVEQAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|167854811|ref|ZP_02477589.1| glycyl-tRNA synthetase subunit beta [Haemophilus parasuis 29755]
 gi|167854109|gb|EDS25345.1| glycyl-tRNA synthetase subunit beta [Haemophilus parasuis 29755]
          Length = 689

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 209/722 (28%), Positives = 348/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +  +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEAELNQAGLSFDKVEWFAAPRRLAVKVLGLATS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ +  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWAKGCGITVEQAERIATD--KGEWLIHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  A+ K+P PK+MRW           ++RP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLVGIISQALAKLPIPKTMRWGDKTE-----QFVRPVHTVTLLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++   D Y   L+E   V+ D   R+  IL  A  
Sbjct: 173 IEGEILGVASGTTVRGHRFLGEREFQISHADQYPALLKEKGSVVADFNERKALILAKAQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + LS  +     
Sbjct: 450 SSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLSDLVATSAK 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       + ++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNSNVVEEVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +      + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISSEIDRTLLVEAEEKALAEQVITLQAELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
              +   Y    D L  + E ++ FFD+V+VN +D ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PLFEKGEYQTALDRLAGLREVVDNFFDKVMVNAEDPKLRQNRQAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|206579067|ref|YP_002236067.1| glycyl-tRNA synthetase, beta subunit [Klebsiella pneumoniae 342]
 gi|238064853|sp|B5XMY7|SYGB_KLEP3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|206568125|gb|ACI09901.1| glycyl-tRNA synthetase, beta subunit [Klebsiella pneumoniae 342]
          Length = 689

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSENTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMIASSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  IP   +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIPSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGQADLSESLLEEVTSLVEWPVVLTAKFEEKFLGVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGEKLTNANVVDDVIDFMLGRFRAWYQDEGYGVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K +  ++  +    L   AE +L   +    
Sbjct: 566 AVSHFRTLEESSALAAANKRVSNILA---KSDETLNDIVHASVLKEAAEIKLAGNLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY      L ++ EP++ FF+ V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFAAGRYQDALIELAALREPVDEFFENVMVNAEDKDVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|156936270|ref|YP_001440187.1| glycyl-tRNA synthetase subunit beta [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166227913|sp|A7MKS3|SYGB_ENTS8 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|156534524|gb|ABU79350.1| hypothetical protein ESA_04169 [Cronobacter sakazakii ATCC BAA-894]
          Length = 689

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDAAGLAHGVVSWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  + 
Sbjct: 61  LAASQPDREVEKRGPAVSAAFDAEGNPSKAAEGWARGCGITVDQAERLVTD--KGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAQALLPNMVSTALSKLPIPKLMRWGASD-----VQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++   +  I    +  GHRF       +   D Y +  LE   V+ D   R+  I  
Sbjct: 169 DDEVLPATILGIQSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYNARKAKIQQ 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYGTDGKLLPNFIFVANIESKD-PRQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGTLRDKTDRIQALSGWIASQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGESEDVAVALNEQYMPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 SLVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                +++ F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGSKLTNAKVVDDVVDFMLGRFRAWYQDEGYSVDTIQAVLANRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++ E+    L  + E RL   ++   
Sbjct: 566 AVSHFRTLDEAVALAAANKRVSNILA---KATEPLNDEVHASVLKEDPEIRLALQVAVMR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L  + EP++ FF++V+VN DD +VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPLFAEGRYQEALVELAQLREPVDEFFEKVMVNADDAQVRINRLTLLSKLRALFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|257465118|ref|ZP_05629489.1| glycyl-tRNA synthetase subunit beta [Actinobacillus minor 202]
 gi|257450778|gb|EEV24821.1| glycyl-tRNA synthetase subunit beta [Actinobacillus minor 202]
          Length = 689

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 209/722 (28%), Positives = 349/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +  +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEAELNQAGLSFDKVEWFAAPRRLAVKVLGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ +  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWAKGCGITVEQAERIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  A+ K+P PK+MRW           ++RP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLVGIISQALAKLPIPKTMRWGDKTE-----QFVRPVHTVTLLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++   D Y   L+E   V+ D   R+  IL  A  
Sbjct: 173 IEGEILGVASGTTVRGHRFLGEREFQISHADQYPALLKEKGSVVADFNERKALILAKAQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  +AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL    V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLKT--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I ++P GS DP+ALRRA LG +RII+E  + + LS  +     
Sbjct: 450 SSVALADKFDTLTGIFGIGQQPKGSADPFALRRAALGALRIIVEKNLPLDLSDLVATSAK 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       + ++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNSNVVEEVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +      + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISSEIDRTLLVEAEEKALAEQVIALQAELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
              +   Y    D L  + E ++ FFD+V+VN ++ ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PLFEKGEYQTALDRLAGLREVVDNFFDKVMVNAEEPKLRQNRQAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|260599858|ref|YP_003212429.1| glycyl-tRNA synthetase subunit beta [Cronobacter turicensis z3032]
 gi|260219035|emb|CBA34390.1| Glycyl-tRNA synthetase beta subunit [Cronobacter turicensis z3032]
          Length = 689

 Score =  643 bits (1658), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDAAGLTHGVVSWFAAPRRLALKVAS 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  + 
Sbjct: 61  LAASQPDREVEKRGPAVSAAFDAEGNPSKAAEGWARGCGITVDQAERLVTD--KGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAQALLPNMVSTALSKLPIPKLMRWGASD-----VQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++   +  I    +  GHRF       +   D Y +  LE   V+ D   R+  I  
Sbjct: 169 DDEVLPATILGIQSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYNARKAKIQQ 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYGTDGKLLPNFIFVANIESRD-PHQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGTLRDKTDRIQALSGWIANQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGESEDVAVALNEQYMPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  V++ADK+DTL   + I + P G KDP+ALRRA LG +RII+E  + + L    E
Sbjct: 446 SLVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                +++ F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGSKLTNAKVVDDVVDFMLGRFRAWYQDEGYSVDTIQAVLANRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K N  ++ E+    L  + E RL   ++   
Sbjct: 566 AVSHFRTLDEAVALAAANKRVSNILA---KANEPLNDEVHASVLKEDPEIRLALQVAVMR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L  + EP++ FF++V+VN DD +VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPLFAEGRYQEALVELAQLREPVDEFFEKVMVNADDAQVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|240948882|ref|ZP_04753238.1| glycyl-tRNA synthetase subunit beta [Actinobacillus minor NM305]
 gi|240296697|gb|EER47308.1| glycyl-tRNA synthetase subunit beta [Actinobacillus minor NM305]
          Length = 689

 Score =  642 bits (1657), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/722 (29%), Positives = 348/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +  +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEAELNQAGLSFDKVEWFAAPRRLAVKVLGLATS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ +  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWAKGCGITVEQAERIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  ++  A+ K+P PK+MRW           ++RP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLVGMISNALAKLPIPKTMRWGDKTE-----QFVRPVHTVTLLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  I  G    GHRF      ++   D Y   L+E   V+ D   R+  IL  A  
Sbjct: 173 IEGEILGIASGTTIRGHRFLGEREFQISHADQYPALLKEKGSVVADFNERKALILAKAQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           +EG L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KEGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + LS  +     
Sbjct: 450 SSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLSDLVATSAK 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       + ++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNSNVVEEVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +      + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISSEIDRTLLVEAEEKALAEQVITLQAELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
              +   Y    D L  + E ++ FFD+V+VN +D ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PLFEKGEYQTALDRLAGLREVVDNFFDKVMVNAEDPKLRQNRQAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|288933065|ref|YP_003437124.1| glycyl-tRNA synthetase subunit beta [Klebsiella variicola At-22]
 gi|288887794|gb|ADC56112.1| glycyl-tRNA synthetase, beta subunit [Klebsiella variicola At-22]
          Length = 689

 Score =  642 bits (1657), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSENTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMIASSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  IP   +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIPSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGQADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGEKLTNANVVDDVIDFMLGRFRAWYQDEGYGVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K +  ++  +    L   AE +L   +    
Sbjct: 566 AVSHFRTLEESSALAAANKRVSNILA---KSDETLNDIVHASVLKEAAEIKLAGNLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY      L ++ EP++ FF+ V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFAAGRYQDALIELAALREPVDEFFENVMVNAEDKDVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|255263205|ref|ZP_05342547.1| glycyl-tRNA synthetase, beta subunit [Thalassiobium sp. R2A62]
 gi|255105540|gb|EET48214.1| glycyl-tRNA synthetase, beta subunit [Thalassiobium sp. R2A62]
          Length = 699

 Score =  642 bits (1657), Expect = 0.0,   Method: Composition-based stats.
 Identities = 281/724 (38%), Positives = 404/724 (55%), Gaps = 50/724 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D L+E++SEEIPARMQ KAA+DL  ++   L E G+ Y +   + TP RL L ++GL+
Sbjct: 1   MSDLLIELFSEEIPARMQAKAADDLKRLVTNGLVEAGLTYASAGAFSTPRRLVLTVEGLN 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GPR  A +KA++GFLRSTGL    D   ++D KKG V+ A++ KP R  
Sbjct: 61  DRSADVREERKGPRTDAPEKALEGFLRSTGLT--KDQLEERDDKKGAVWFAIVEKPGRAA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL SILCIL AED   +++ LD+
Sbjct: 119 SEIVAEVLDATIRNFPWPKSMRWGN-----GSLRWVRPLHSILCILSAED-GAEVVPLDV 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G++T+GHRF AP  IKV + D     L++A V+LD   R  AI  DA   A A G
Sbjct: 173 DGIVSGDVTFGHRFLAPDAIKVVNFDDCSTKLKQAYVVLDASERAEAIWADATNQAFANG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE++ED+ LL E+ GLVEW  V MG   K YL LP E+++L++K +QK F  +  +    
Sbjct: 233 LEVIEDRGLLAEVAGLVEWPVVLMGPIAKDYLNLPSEVLQLSMKEHQKFFSVKNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+NI+ +D GA I+ GN RV++ARL D   FW+ D     +       A      
Sbjct: 293 EQFITVANIETADNGATILAGNGRVLSARLADGKFFWENDLREAKSGMKGWLQA------ 346

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                        + +V FH K+G+  E++ RI  L   +A    AD  +   A  LSKA
Sbjct: 347 -------------LENVTFHNKLGSVAEQIERISDLSGHLAATTGADPVMATTAAQLSKA 393

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ Y+     + +   AIEEH  P GP ++VPT  +S+ V+LA
Sbjct: 394 DLSSEMVYEFPELQGVMGRYYSAEAGHDAAIGAAIEEHYSPLGPSDDVPTAPVSMAVALA 453

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
            K+DTL  FW I+EKP+GSKDP+ALRRA LG+IR+ +EN +   L      Q        
Sbjct: 454 AKVDTLAGFWVIDEKPTGSKDPFALRRAALGVIRLAVENDLRFGLRDVFARQATVVSKAQ 513

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEA-ILRPENDNLLTIVDLIKHLN 578
                        +L+ F HDRLK+YL DR ++HD+I+A +  P ND+L  +V   + L+
Sbjct: 514 DGSDGVDSDAISDSLMGFVHDRLKVYLKDRGVKHDVIDASVAMPGNDDLSLLVRRAEALS 573

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTH 637
            F  +  GE  +   KR   +L  EEKK+  E S     ++   + E+ L+A +      
Sbjct: 574 GFLRTDDGENLVQGFKRANNMLTAEEKKDGVEYSFGADIKFAETDEERALFAALDAGEPA 633

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
           I  +M  + +      +  +  P++ FF  V VN D   +R NRL+LL  I    L V +
Sbjct: 634 IVAAMGAEDFETAMAAMAQLRGPVDAFFKAVKVNADSDVIRRNRLNLLSRISKTCLSVAD 693

Query: 698 VQKI 701
           + ++
Sbjct: 694 LTRL 697


>gi|309751409|gb|ADO81393.1| Glycyl-tRNA synthetase, beta subunit [Haemophilus influenzae R2866]
          Length = 688

 Score =  642 bits (1657), Expect = 0.0,   Method: Composition-based stats.
 Identities = 211/720 (29%), Positives = 345/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLIHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLCEKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGRLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  K+GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQKLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRMPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|330002313|ref|ZP_08304293.1| glycine--tRNA ligase, beta subunit [Klebsiella sp. MS 92-3]
 gi|328537334|gb|EGF63585.1| glycine--tRNA ligase, beta subunit [Klebsiella sp. MS 92-3]
          Length = 689

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSENTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMIASSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  IP   +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIPSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGQADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGEKLTNANVVDDVIDFMLGRFRAWYQDEGYGVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K +  ++  +    L   AE +L   +    
Sbjct: 566 AVSHFRTLEESSALAAANKRVSNILA---KSDETLNDIVHASVLKEAAEIKLAGNLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY      L ++ EP++ FF+ V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFAAGRYQDALIELAALREPVDEFFENVMVNAEDKDVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|145634100|ref|ZP_01789811.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittAA]
 gi|145268544|gb|EDK08537.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittAA]
          Length = 688

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 345/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNGIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KAAALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAMPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFSDKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLVLRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|145630016|ref|ZP_01785798.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae R3021]
 gi|144984297|gb|EDJ91720.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae R3021]
          Length = 688

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 344/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLIHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRVPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|315633368|ref|ZP_07888659.1| glycyl-tRNA synthetase beta subunit [Aggregatibacter segnis ATCC
           33393]
 gi|315477868|gb|EFU68609.1| glycyl-tRNA synthetase beta subunit [Aggregatibacter segnis ATCC
           33393]
          Length = 688

 Score =  642 bits (1656), Expect = 0.0,   Method: Composition-based stats.
 Identities = 207/722 (28%), Positives = 343/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGNKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  E         I     +  AE+ L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVANILAKAEGD----IGAIDVALCVEPAEQVLAQSVLSLAKEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L  + +P++ FFD V+VN +D ++R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGEYTAVLDKLAGLRQPVDNFFDNVMVNAEDAKLRQNRLAILNTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|283835937|ref|ZP_06355678.1| glycyl-tRNA synthetase, beta subunit [Citrobacter youngae ATCC
           29220]
 gi|291068114|gb|EFE06223.1| glycyl-tRNA synthetase, beta subunit [Citrobacter youngae ATCC
           29220]
          Length = 689

 Score =  642 bits (1655), Expect = 0.0,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  + TP RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGIAHGNVEWFATPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAQAQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAETLLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + S D Y   L     V+ D   R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDSADQYPEILRERGKVIADYAERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F+ K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVTSLVEWPVVLTAKFEDKFLAVPSEALVHTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFYTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF-- 528
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L+    
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLNLTTLIL 505

Query: 529 -------------IEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
                            ++  F  +R + +  D     D+I ++L       +     +K
Sbjct: 506 KASRLYGDKLTNDNVLDDVETFMLNRFRAWYQDMGYSIDVILSVLELRPTEPVDFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F S         + KR+  IL+   K+   ++ E+ P  L    E+ L   ++   
Sbjct: 566 AVTHFRSLPDAASLAAANKRVSNILS---KRVDVLNDEVHPALLTEPTEQVLAFKMAVVR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             I+    H  Y +    L S+ +P++ FF+ V+VN ++++VR NRL+LL  ++ + L V
Sbjct: 623 DRIKPLCQHFLYQEALTELASLRQPVDDFFENVMVNAENQDVRINRLTLLSKLRALFLEV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|219871686|ref|YP_002476061.1| glycyl-tRNA synthetase subunit beta [Haemophilus parasuis SH0165]
 gi|254781852|sp|B8F711|SYGB_HAEPS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|219691890|gb|ACL33113.1| glycyl-tRNA synthetase subunit beta [Haemophilus parasuis SH0165]
          Length = 689

 Score =  642 bits (1655), Expect = 0.0,   Method: Composition-based stats.
 Identities = 208/722 (28%), Positives = 348/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +  +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEAELNQAGLSFDKVEWFAAPRRLAVKVLGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ +  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWAKGCGITVEQAERIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  A+ K+P PK+MRW           ++RP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLVGIISQALAKLPIPKTMRWGDKTE-----QFVRPVHTVTLLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++   D Y   L+E   V+ D   R+  IL  A  
Sbjct: 173 IEGEILGVASGTTVRGHRFLGEREFQISHADQYPALLKEKGSVVADFNERKALILAKAQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + LS  +     
Sbjct: 450 SSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLSDLVATSAK 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       + ++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNSNVVEEVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   +IS EI    L+   EK L   +      + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGKISSEIDRTLLVEAEEKALAEQVITLQAELV 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
              +   Y    D L  + E ++ FFD+V+VN +D ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PLFEKGEYQTALDRLAGLREVVDNFFDKVMVNAEDPKLRQNRQAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|319897585|ref|YP_004135782.1| glycine tRNA synthetase, beta subunit [Haemophilus influenzae
           F3031]
 gi|317433091|emb|CBY81465.1| glycine tRNA synthetase, beta subunit [Haemophilus influenzae
           F3031]
          Length = 688

 Score =  641 bits (1654), Expect = 0.0,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 346/720 (48%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLHLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
              K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QLSKEIEKRGPAVSAAFDGEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++ +L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEEHFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLANQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L +     + +AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTV----CVEQAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             ++   Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIEQGDYTTVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|251793743|ref|YP_003008473.1| glycyl-tRNA synthetase subunit beta [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535140|gb|ACS98386.1| glycyl-tRNA synthetase, beta subunit [Aggregatibacter aphrophilus
           NJ8700]
          Length = 688

 Score =  640 bits (1652), Expect = 0.0,   Method: Composition-based stats.
 Identities = 208/722 (28%), Positives = 343/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA DG+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAADGWARGCGITVEQAERIATD--KGEWLVRRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEGLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SVVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSTA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDDGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  E         I     +  AE+ L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVANILAKAEGDV----GAIDVALCVEPAEQVLAQSVLSLAKEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L  + +P++ FFD V+VN +D ++R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGEYTAVLDKLAGLRQPVDNFFDNVMVNAEDAKLRQNRLAILNTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|254293492|ref|YP_003059515.1| glycyl-tRNA synthetase subunit beta [Hirschia baltica ATCC 49814]
 gi|254042023|gb|ACT58818.1| glycyl-tRNA synthetase, beta subunit [Hirschia baltica ATCC 49814]
          Length = 722

 Score =  640 bits (1652), Expect = 0.0,   Method: Composition-based stats.
 Identities = 272/752 (36%), Positives = 406/752 (53%), Gaps = 83/752 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP  LLE++ EEIPARMQ KA  DL   ++  L E G++ + ++ +  P RL +  +GL 
Sbjct: 1   MPQLLLELFCEEIPARMQAKAQADLERAVMDKLSEAGLMAEGVKAFSGPRRLCVVAEGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EER GP+VGA +KAI GFLR  GL +I   +I++D KKG  Y+AV+ KP    
Sbjct: 61  VKSADVREERKGPKVGAPEKAIAGFLRGAGLDSIEQAEIQEDKKKGQFYVAVINKPGVET 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
             ++  +VP  ++   WPKSMRW +         W+RPL+ ILC    E     ++  ++
Sbjct: 121 TQIIANMVPEIVRSFHWPKSMRWGSRE-----MRWVRPLQRILCTFDGE-----VVPFEI 170

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHRLASAV 239
             I   N+T GHR     P KV+  D Y   L+    V+ D + R++ I  +A  L  A 
Sbjct: 171 DGIASSNVTQGHRVMGAGPFKVRRFDDYSDILKNKGRVIYDRDERKDIIATEAKTLCDAQ 230

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TREGV 298
           GLELV D  LLEE+ GL E+  V MG  D K+L LP E+I L+++ +QK F  R  + G 
Sbjct: 231 GLELVPDIGLLEEVAGLAEFPVVIMGDMDPKFLALPPEVITLSMRVHQKYFAVRDPKTGK 290

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           LA  FI+V+N++A DGG  I  GNS+V++ARL DA+ F++ D+                 
Sbjct: 291 LAPKFIVVANLEAEDGGKTIAAGNSKVLSARLSDAVFFYENDK----------------- 333

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
              +K L++R   L   ++VFH K+GT  ++  R+  L  ++A ++ A       A  L+
Sbjct: 334 ---AKKLEERFDSLG--NIVFHEKLGTVKDKAERVAALAGELAPIVGAKKEDAIAAAKLA 388

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           K DL  E+V EF EL+G +G+ YA+ + +     D I +H KP+GP ++VPT   ++ V+
Sbjct: 389 KCDLVAEMVFEFTELEGVMGRYYAMEEGQPQHIADTIRDHYKPKGPSDDVPTEPTAVAVA 448

Query: 479 LADKLDTLINFWA-INEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------ 531
           LADKLDTL + +  INE P+GSKDPYALRR+ LG+IR++LEN I + L     +      
Sbjct: 449 LADKLDTLCSGFWTINELPTGSKDPYALRRSALGVIRLVLENNIRLKLEPCFSELAEIGF 508

Query: 532 -----------------------------------------QNLILFFHDRLKLYLHDRD 550
                                                    QNL+ FF DRLK+YL D+ 
Sbjct: 509 ALSPVSKAHWTEMWKLSQDVEADGTTFIEGTGFKDEAQTLAQNLLSFFEDRLKVYLRDKG 568

Query: 551 IRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNRE- 609
           IRHDL++A+     D+L+ IV  ++ L  F  +  G+  +   KR   IL  EEKK+   
Sbjct: 569 IRHDLLDAVFSLGGDDLVLIVKRVEALGSFLETEDGKNLVSGHKRATNILQKEEKKDGSA 628

Query: 610 ISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVL 669
           I+ EI  + L   AE  L+  ++    + + ++  + +      L  +  P++ FFD V+
Sbjct: 629 ITGEIDKKLLSDAAELALHEALNVATANAEAALKKEDFEGAMSALSLLRGPVDTFFDDVI 688

Query: 670 VNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           VN +D +VR+NRL LL  I+++   V +  KI
Sbjct: 689 VNAEDNKVRENRLKLLARIRDVTSQVADFSKI 720


>gi|260581758|ref|ZP_05849555.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae NT127]
 gi|260095351|gb|EEW79242.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae NT127]
          Length = 688

 Score =  640 bits (1651), Expect = 0.0,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 345/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLTFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEMEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLIHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L +   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLRDKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     +++LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEENLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLLRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA       EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKAGAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRAPVDNFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|145636932|ref|ZP_01792596.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittHH]
 gi|145269790|gb|EDK09729.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittHH]
          Length = 688

 Score =  640 bits (1651), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 344/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 KGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLLRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLSRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRVPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|254362729|ref|ZP_04978813.1| glycine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261491870|ref|ZP_05988449.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|153094354|gb|EDN75209.1| glycine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261312525|gb|EEY13649.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 688

 Score =  640 bits (1650), Expect = 0.0,   Method: Composition-based stats.
 Identities = 200/722 (27%), Positives = 352/722 (48%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL + +  L+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKVLSLAES 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ +  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWAKGCGITVEQAERIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK+MRW           ++RP+ ++  +  AE     +
Sbjct: 123 EGQPTKNLLVDIIAKSLANLPIPKTMRWGDKTE-----QFVRPVHTVTLLFGAE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++++ D Y + L++   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKSGRTIRGHRFLGEREFQIENADQYPQLLKDRGSVVADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F   +
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYS 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQKLEDQLPRLET--VLFQQQLGTLRDKTARIEALAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   +N+P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDNLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L+  +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLTDLVAKSAQ 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +     I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNKDVVEDVVDFMLGRFRAWYESEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +        +I     +  AEK L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKAD----IAIGDIDVSACVEPAEKALAEAVIALKAEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++ +P++ FFD V+VN +D+++R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRQPVDAFFDGVMVNAEDQKLRQNRLAILSTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|159044945|ref|YP_001533739.1| glycyl-tRNA synthetase subunit beta [Dinoroseobacter shibae DFL 12]
 gi|238686865|sp|A8LS45|SYGB_DINSH RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|157912705|gb|ABV94138.1| glycyl-tRNA synthetase beta chain [Dinoroseobacter shibae DFL 12]
          Length = 720

 Score =  640 bits (1650), Expect = 0.0,   Method: Composition-based stats.
 Identities = 275/745 (36%), Positives = 397/745 (53%), Gaps = 71/745 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ L+E++SEEIPARMQ +AA+DL  ++   L E G+ Y   R Y TP RL L +  + 
Sbjct: 1   MPELLIELFSEEIPARMQARAAQDLQKLVTNGLVEAGITYAGARAYATPRRLTLVVSDML 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GP+  A +KAI+GFLRSTGL         ++  KGDV  AV+ KP R  
Sbjct: 61  AASAPVREERKGPKADAPEKAIEGFLRSTGLGREQLET--RETPKGDVLFAVIEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW +     S+  W+RPL  ILC++  E    +I+ L +
Sbjct: 119 AEIVAEVLETTIRNFPWPKSMRWGS-----SSLRWVRPLHRILCLIRDE-EGAEIVPLTV 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G++T GHRF AP  IKV   + Y   L  A V+LD E R   I  DA   A A G
Sbjct: 173 DGITAGDVTEGHRFLAPGEIKVHGFEDYETKLRRAKVILDAEERAEHIWADATNQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VED+ LL E+ GLVE+    MG  D  +L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LEVVEDRRLLSEVAGLVEFPVPLMGEIDADFLDLPPEVLQTSMKEHQKFFSVRDLKSGKI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D GA I+ GN +V++ARL DA  FW+ D                    
Sbjct: 293 VRFVTVANTETTDHGATILAGNRKVLSARLADAKFFWENDLRIARAGMQPW--------- 343

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                     R  + +V FH K+G+Q  R++RI  L   +A  + AD      A  L+KA
Sbjct: 344 ----------REALENVTFHNKLGSQAARIARIADLAATLAPQVGADPDAARTAAELAKA 393

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA             ++H +P GP + VPT  +SI V+LA
Sbjct: 394 DLSSEMVFEFPELQGLMGRYYAEAAGHPAEIAAVAQDHYQPLGPSDAVPTAPLSIAVALA 453

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQ------------- 527
           DKLDTL  FWAI+EKP+GSKDP+ALRRA LG+IRI+LEN + +PL               
Sbjct: 454 DKLDTLTGFWAIDEKPTGSKDPFALRRAALGVIRIVLENGLRLPLINSVKHHNSENTSRP 513

Query: 528 -----------------------------FIEDQNLILFFHDRLKLYLHDRDIRHDLIEA 558
                                             +L+ FFHDRLK++L D  IRHD+I+A
Sbjct: 514 LFSALVAHAKTDQERADGSKSMSDWKALVARSQDDLLSFFHDRLKVFLRDEGIRHDIIDA 573

Query: 559 ILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISP 616
            L    ND+LL +V+  + L+E   +  GE  L   KR   IL   E+ +  E S    P
Sbjct: 574 CLAMEGNDDLLLLVNRARALSETLKTEDGENLLQGFKRANNILTQAEEADGVEYSYGADP 633

Query: 617 QYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDRE 676
           ++   + E+ L+A +      I  +++ + +      + S+  P++ FF+ V VN +++ 
Sbjct: 634 KFAETDEERALFAALDTAEAVIDPALEAEDFAAATAAMASLRAPLDAFFEAVQVNAENQI 693

Query: 677 VRDNRLSLLQYIKNIILIVINVQKI 701
           +R NRL+LL  I+   L + ++ +I
Sbjct: 694 LRRNRLNLLSRIRATCLKLADLTRI 718


>gi|148826424|ref|YP_001291177.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae PittEE]
 gi|229845983|ref|ZP_04466095.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae 7P49H1]
 gi|166227914|sp|A5UDE3|SYGB_HAEIE RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|148716584|gb|ABQ98794.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae PittEE]
 gi|229810987|gb|EEP46704.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae 7P49H1]
 gi|309973574|gb|ADO96775.1| Glycyl-tRNA synthetase, beta subunit [Haemophilus influenzae R2846]
          Length = 688

 Score =  640 bits (1650), Expect = 0.0,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 345/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELIQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHCAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFSDKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLVLRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|316932589|ref|YP_004107571.1| glycyl-tRNA synthetase subunit beta [Rhodopseudomonas palustris
           DX-1]
 gi|315600303|gb|ADU42838.1| glycyl-tRNA synthetase, beta subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 746

 Score =  639 bits (1649), Expect = 0.0,   Method: Composition-based stats.
 Identities = 302/766 (39%), Positives = 417/766 (54%), Gaps = 87/766 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA+DL  ++   L  EG++Y+  + + TP RL L + G+ 
Sbjct: 1   MPDLLLELFSEEIPARMQGKAADDLKRLVTDKLVAEGLVYEGAKAFATPRRLTLTVHGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  +ER GP+VGA   A+ GFL++TGL ++ + +I++DPKKGD Y+A++ KP R  
Sbjct: 61  ARQPDLKDERKGPKVGAPDAAVQGFLKATGLASLDEAKIQRDPKKGDFYVALIEKPGRPA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +V+  I+PV ++  PWPKSMRW    +   A  W+RPL SI+     +  +  ++  ++
Sbjct: 121 IEVIAEILPVIVRTFPWPKSMRWGARSAKPGALQWVRPLHSIVATFGIDTEEPDVVHFNV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  T GHRF AP   +V+  + Y   L  A V+LDP+ RR+ IL DA  LA A  
Sbjct: 181 DGIEAGQTTRGHRFMAPDAFEVRRFEDYEAKLFAAKVVLDPQRRRDIILADAKTLAQAQN 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGVL 299
            ELVED  LL+E+ GLVEW    MGSFDK +L +P+E+IR TI+ NQKCFV      G L
Sbjct: 241 YELVEDAGLLDEVSGLVEWPVPLMGSFDKDFLSIPDEVIRATIRANQKCFVVADPATGKL 300

Query: 300 ANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNL 359
           AN FIL +NI+ASDGGAAI  GN RV+ ARL DA  F++ D                   
Sbjct: 301 ANKFILTANIEASDGGAAITAGNERVIRARLSDAKFFYETD------------------- 341

Query: 360 DLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSK 419
            L   L+ R+ + D   +VFH K+GTQ ER+ RI  L  +IA L+ ADV    RA  L K
Sbjct: 342 -LKTKLEDRLPKFDQ--IVFHEKLGTQAERIERIERLAAEIAPLVGADVEKTKRAAKLCK 398

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPELQG +GK YA+ Q E+ S   A EEH KP+GP + VPT+ +SI V+L
Sbjct: 399 ADLLTEVVGEFPELQGLMGKYYALAQGEDASVAAACEEHYKPQGPADRVPTDPVSIAVAL 458

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPL-------------- 525
           ADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR+I++NK+ + +              
Sbjct: 459 ADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLIVDNKLRLNIFDLSARPFARNAKA 518

Query: 526 ---SQFIEDQNLILFFHD-----------------RLKLYLHDRDIRHDLIEAILRP--- 562
               +F     L+    D                 R +       +   + +A L     
Sbjct: 519 VLFDEFRAAMELVQRVEDELPPGTIISISELATAFRYRQIAEADLVAGQMRKAALDLLSF 578

Query: 563 --------------------------ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRI 596
                                       D++L IV  ++ L  F ++  G+  L   KR 
Sbjct: 579 FADRLKVQLRDQGARHDLVDAVFALEGQDDILMIVRRVEALAAFLATDDGKNLLAGTKRA 638

Query: 597 FQILAIEEKKN-REISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLH 655
             IL IEEKK+ R             + E+ L A I         ++  + +      + 
Sbjct: 639 ANILRIEEKKDGRAFDGAPDASLYAQDEERALAAAIDRAKAEAGAAVAKEDFAAAMTAMA 698

Query: 656 SICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            +   ++ FFD+V VN DD+ VR+NRL LL  I+     V +  KI
Sbjct: 699 GLRPAVDAFFDKVTVNADDKAVRENRLKLLNEIRAATRAVADFSKI 744


>gi|126461281|ref|YP_001042395.1| glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides ATCC
           17029]
 gi|229558571|sp|A3PH07|SYGB_RHOS1 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|126102945|gb|ABN75623.1| Glycine--tRNA ligase [Rhodobacter sphaeroides ATCC 17029]
          Length = 697

 Score =  639 bits (1649), Expect = 0.0,   Method: Composition-based stats.
 Identities = 266/721 (36%), Positives = 392/721 (54%), Gaps = 46/721 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +A EDL  ++   L E G+ Y +   + TP RL L ++GLS
Sbjct: 1   MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGAFSTPRRLVLSVEGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+  A   AI+GFLRSTGL         ++ KKG V  AV+ KP R  
Sbjct: 61  AESPTLREERKGPKADAPAAAIEGFLRSTGLTRDRLET--REDKKGAVLFAVVEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL+SILC+L  E    +++ + L
Sbjct: 119 PEIVAEVLERTIRTFPWPKSMRWG-----TGSLRWVRPLQSILCLLSDE-GGAEVVPMTL 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  GN T GHRF AP    V   + Y   L  A V+LD   R  AI ++A   A A G
Sbjct: 173 DGLTAGNSTEGHRFMAPARFAVSGFEDYRAKLGRAFVMLDASEREQAIWHEATTQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V D  LL E+ GLVEW  V MG+  + +L LP E+++ +++ +QK F          
Sbjct: 233 LEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKFFSVTNPATGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D G  I++GN +V++ARL DA  FW+ D   +                
Sbjct: 293 EKFVTVANRETADHGETILKGNGKVLSARLSDARFFWENDLRTVKTAG------------ 340

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+     L    V FH ++G+Q +R++RI  L ++IA L+ A   L   A  ++KA
Sbjct: 341 ----LEGMAEGLKQ--VTFHNRLGSQADRIARIEALAREIAPLVGASPDLAAEAARVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G  YA       +   A + H +P GP + VPT+ +S+ V+LA
Sbjct: 395 DLQSAMVGEFPELQGTMGSYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSVAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DK+DTL  FW I EKP+GSKDP+ALRRA LG+IR++L N     L   +           
Sbjct: 455 DKIDTLAGFWRIGEKPTGSKDPFALRRAALGVIRLLLTNNSRAGLMGIMLPAMNRHLEPF 514

Query: 530 -------EDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFF 581
                   ++ L+ FFHDRLK++L ++ IRHD+I+A L  P ND+L  +V   + L+ F 
Sbjct: 515 DTSDFTPYERELLSFFHDRLKVHLREQGIRHDVIDACLAMPGNDDLTLLVKRAEALSAFL 574

Query: 582 SSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            +  G   L   KR   IL   E K+  E S    P++   +AE+ L+A +      I  
Sbjct: 575 KTDDGTNLLQGFKRANNILTQAEAKDGVEYSFGADPKFAETDAERALFAALETAEAAIGP 634

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
           ++  + +      + ++  PI+ FF+ V VN D+  +R NRL++L  I+     V ++ +
Sbjct: 635 ALQAEDFAAAMSAMAALRAPIDAFFETVQVNADNAVLRRNRLNMLHSIRATCARVADLTR 694

Query: 701 I 701
           I
Sbjct: 695 I 695


>gi|85711017|ref|ZP_01042078.1| glycyl-tRNA synthetase beta subunit [Idiomarina baltica OS145]
 gi|85695421|gb|EAQ33358.1| glycyl-tRNA synthetase beta subunit [Idiomarina baltica OS145]
          Length = 688

 Score =  639 bits (1649), Expect = 0.0,   Method: Composition-based stats.
 Identities = 214/721 (29%), Positives = 354/721 (49%), Gaps = 60/721 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
             L+E+ +EE+P +   + +E     +   L +  + +  ++   TP RL + +  L   
Sbjct: 5   TLLVELGTEELPPKALKQLSESFKHGIEEGLNKAELAFGEIKALATPRRLAVLVNSLEGQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +K+ E+ GP V       G   KA  G+ RS G++     +++ D  KG   L     
Sbjct: 65  QQDKVVEKRGPSVDVAFDEAGQPTKAAQGWARSNGIEVSEAERLETD--KGAWLLHKAEV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
               +  VL  IV  A++K+P PK MRW  + +      +IRP+ ++  +       +++
Sbjct: 123 KGESLAQVLPGIVEDALKKLPIPKPMRWGDSDA-----QFIRPVHTLTLLF-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRL 235
           I+  L  I  G     HRFHAP    +Q  D Y   L +  V+ D   R   I    + L
Sbjct: 173 INASLLGIKSGRHINAHRFHAPDGFDIQHADDYEAQLYKHHVIADQAKRMELIRTSINDL 232

Query: 236 ASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR 295
           AS +G  +  D+DL+EE+  LVEW      SFD+++L +P+E + +T+K +Q+ F  +  
Sbjct: 233 ASQLGGTVETDEDLVEEVSALVEWPVALSASFDEQFLTVPKEALIVTMKDDQRYFPVQDD 292

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
           +G L   FI ++NI + D    I++GN RVV  RL DA  F++ D+              
Sbjct: 293 KGELKPVFIFITNIDSKD-PKQIIKGNERVVRPRLADAQFFFESDK-------------- 337

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAI 415
                    L  R+ +L    V+F  ++GT  ++  RI  L  +IA  ++AD      A 
Sbjct: 338 ------KVTLSSRLDKLGT--VLFQKQLGTMKDKSERISRLSARIAGSLNADEQHARLAG 389

Query: 416 VLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISI 475
            L K DL T++V EFPE QG +G+ YA+    +    DAIE+H  PR   +N+PT+ +S 
Sbjct: 390 ELCKTDLVTDMVSEFPETQGVMGRHYALNDGLDAEVADAIEQHYWPRFAGDNLPTSDVSR 449

Query: 476 TVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE----- 530
           +V+LADKLD+L+  + I + P G +DP+ALRRA LG+IRII+E+ +++ L + I+     
Sbjct: 450 SVALADKLDSLVGIFGIGQTPKGDRDPFALRRAALGLIRIIVESNLNLDLYELIDAAIGE 509

Query: 531 ----------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEF 580
                      +N+  F   R + +  ++ I  D+I+A+L             I  ++ F
Sbjct: 510 FGDRLSNNDVRENVFNFIIGRFRPWYQEQGISVDVIQAVLARAPSRPADFNLRIHAVDAF 569

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
                 E    + KR+  IL+   K   +++ +I    L+   EK L A IS+     + 
Sbjct: 570 KQHDAAESLSAANKRVGNILS---KSEGDLTGKIDHTLLVAAEEKTLAAQISETEKSAEP 626

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
            +    Y      + S+  PI+ FF+ V+VN +D  VR NRL+LL  ++ + L V ++  
Sbjct: 627 EIAAGNYEGALTRMASLKSPIDDFFENVMVNDEDPAVRQNRLNLLYQLRGMFLRVADISL 686

Query: 701 I 701
           +
Sbjct: 687 L 687


>gi|294638314|ref|ZP_06716567.1| glycyl-tRNA synthetase, beta subunit [Edwardsiella tarda ATCC
           23685]
 gi|291088567|gb|EFE21128.1| glycyl-tRNA synthetase, beta subunit [Edwardsiella tarda ATCC
           23685]
          Length = 689

 Score =  639 bits (1648), Expect = 0.0,   Method: Composition-based stats.
 Identities = 200/720 (27%), Positives = 343/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     A+  +      L   G+ + ++  +  P RL L +  L   
Sbjct: 5   TFLVEIGTEELPPKALRSLAQAFADNFRSELDNAGLAHGDIAWFAAPRRLALKVAALDAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L   ++
Sbjct: 65  QPDREIEKRGPAIAQAFDADGKPTKAAEGWARGCGISVEQAERL--TTDKGEWLLYRAQQ 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L T+V  A+ ++P PK MRW    +      ++RP+ ++  +L +E      
Sbjct: 123 KGQRAQELLPTLVANALSRLPIPKLMRWGANDT-----QFVRPVHTVTLLLGSE-----S 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAQIKRDAEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+ +G +      LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAARIGGQADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            +G L   FI V+N+ + D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AQGKLLPNFIFVANVDSKDA-QQIIAGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++G+  ++  RI  L   IAQ I ADV +  RA
Sbjct: 339 -------KQRLEDNLPRLE--SVLFQQQLGSLRDKTDRIAALAGWIAQQIGADVNMATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      ++ E   PR   + +P++ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEEVAVSLNEQYMPRFAGDALPSSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E K+ + L    ++   
Sbjct: 450 CAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLLTLTQEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  +     D I+A+L             ++ ++ 
Sbjct: 510 LYGDKLSNAKVVEDVVDFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K +  ++ ++    L   AE RL A +      + 
Sbjct: 570 FRTLDEAATLAAANKRVSNILA---KSSDTLADQVQATLLKEAAEIRLAANLITLQEKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ +P++ FF+QV+V  DD +VR NRL+LL  ++++ L V ++ 
Sbjct: 627 PLFAAGQYQEALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLSKLRDLFLQVADIS 686


>gi|261494658|ref|ZP_05991138.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309623|gb|EEY10846.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 688

 Score =  639 bits (1648), Expect = 0.0,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 351/722 (48%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL + +  L+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQSGLAFEKVEWFAAPRRLAVKVLSLAES 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEVEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK+MRW           ++RP+ ++  +  AE     +
Sbjct: 123 EGQPTKNLLVDIIAKSLANLPIPKTMRWGDKSE-----QFVRPVHTVTLLFGAE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF       +++ D Y + L++   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKSGRTIRGHRFLGEREFTIENADQYPQLLKDRGSVVADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F   +
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYS 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQKLEDQLPRLET--VLFQQQLGTLRDKTARIEALAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   +N+P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDNLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L+  +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLTDLVAKSAQ 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +     I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNKDVVEDVVDFMLGRFRAWYESEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +        +I     +  AEK L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKAD----IAIGDIDVSACVEPAEKALAEAVIALKAEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++ +P++ FFD V+VN +D+++R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRQPVDAFFDGVMVNAEDQKLRQNRLAILSTLQGLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|77462404|ref|YP_351908.1| glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides 2.4.1]
 gi|123757774|sp|Q3J5C7|SYGB_RHOS4 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|77386822|gb|ABA78007.1| Glycyl-tRNA synthetase, beta subunit [Rhodobacter sphaeroides
           2.4.1]
          Length = 697

 Score =  639 bits (1648), Expect = 0.0,   Method: Composition-based stats.
 Identities = 267/721 (37%), Positives = 393/721 (54%), Gaps = 46/721 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +A EDL  ++   L E G+ Y +   + TP RL L ++GLS
Sbjct: 1   MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGAFSTPRRLVLSVEGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+  A   AI+GFLRSTGL         ++ KKG V  AV+ KP R  
Sbjct: 61  AESPTLREERKGPKADAPAAAIEGFLRSTGLTRDQLET--REDKKGAVLFAVVEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL+SILC+L  E A  +++ + L
Sbjct: 119 PEIVAEVLERTIRTFPWPKSMRWG-----TGSLRWVRPLQSILCLLSDE-AGAEVVPMTL 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  GN T GHRF AP    V   + Y   L  A V+LD   R  AI ++A   A A G
Sbjct: 173 DGLTAGNSTEGHRFMAPARFAVSGFEDYRAKLARAFVMLDASEREQAIWHEATTQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V D  LL E+ GLVEW  V MG+  + +L LP E+++ +++ +QK F          
Sbjct: 233 LEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKFFSVTNPATGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D G  I++GN +V++ARL DA  FW+ D   +                
Sbjct: 293 EKFVTVANRETADHGETILKGNGKVLSARLSDARFFWENDLRTVKTAG------------ 340

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+     L    V FH ++G+Q  R++RI  L ++IA L+ A   L   A  ++KA
Sbjct: 341 ----LEGMAEGLKQ--VTFHNRLGSQAARIARIEALAREIAPLVGASPDLAAEAARVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G  YA       +   A + H +P GP + VPT+ +S+ V+LA
Sbjct: 395 DLQSAMVGEFPELQGTMGSYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSVAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DK+DTL  FW I EKP+GSKDP+ALRRA LG+IR++L N     L   +           
Sbjct: 455 DKIDTLAGFWRIGEKPTGSKDPFALRRAALGVIRLLLTNNSRAGLMGIMLPAMNRHLEPF 514

Query: 530 -------EDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFF 581
                   +++L+ FFHDRLK++L ++ IRHD+I+A L  P ND+L  +V   + L+ F 
Sbjct: 515 DTSDFTPYERDLLAFFHDRLKVHLREQGIRHDVIDACLAMPGNDDLTLLVKRAEALSAFL 574

Query: 582 SSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            +  G   L   KR   IL   E K+  E S    P++   +AE+ L+A +      I  
Sbjct: 575 KTDDGTNLLQGFKRANNILTQAEAKDGVEYSFGADPKFAETDAERALFAALETAEAAIGP 634

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
           ++  + +      + ++  PI+ FF+ V VN D+  +R NRL++L  I+     V ++ +
Sbjct: 635 ALQAEDFAAAMSAMAALRAPIDAFFETVQVNADNAVLRRNRLNMLHSIRATCARVADLTR 694

Query: 701 I 701
           I
Sbjct: 695 I 695


>gi|332560288|ref|ZP_08414610.1| glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides WS8N]
 gi|332278000|gb|EGJ23315.1| glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides WS8N]
          Length = 697

 Score =  638 bits (1646), Expect = 0.0,   Method: Composition-based stats.
 Identities = 269/721 (37%), Positives = 392/721 (54%), Gaps = 46/721 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +A EDL  ++   L E G+ Y +   + TP RL L ++GLS
Sbjct: 1   MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGAFSTPRRLVLSVEGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+  A   AI+GFLRSTGL         ++ KKG V  AV+ KP R  
Sbjct: 61  AESPTLREERKGPKADAPAAAIEGFLRSTGLTRDQLET--REDKKGAVLFAVVEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL+SILC+L  E A  +++ + L
Sbjct: 119 PEIVAEVLERTIRTFPWPKSMRWG-----TGSLRWVRPLQSILCLLSDE-AGAEVVPMTL 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  GN T GHRF AP    V   D Y   L  A V+LD   R  AI ++A   A A G
Sbjct: 173 DGLTAGNSTEGHRFMAPARFAVSGFDDYRAKLARAFVMLDASEREQAIWHEATTQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V D  LL E+ GLVEW  V MG+  + +L LP E+++ +++ +QK F          
Sbjct: 233 LEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKFFSVTNPATGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D GA I++GN +V++ARL DA  FW+ D   +                
Sbjct: 293 EKFVTVANRETADHGATILKGNGKVLSARLSDARFFWENDLRTVKTAG------------ 340

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+     L    V FH  +G+Q  R++RI  L ++IA L+ A   L   A  ++KA
Sbjct: 341 ----LEGMAEGLKQ--VTFHNMLGSQAARIARIEALAREIAPLVGASPDLAAEAARVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G  YA       +   A + H +P GP + VPT+ +S+ V+LA
Sbjct: 395 DLQSAMVGEFPELQGTMGSYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSVAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DK+DTL  FW I EKP+GSKDP+ALRRA LG+IR++L N     L   +           
Sbjct: 455 DKIDTLTGFWRIGEKPTGSKDPFALRRAALGVIRLLLTNNSRAGLMGIMLPAMNRHLEPF 514

Query: 530 -------EDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEFF 581
                   ++ L+ FFHDRLK++L ++ IRHD+I+A L  P ND+L  +V   + L+ F 
Sbjct: 515 DTSDFTPYERELLAFFHDRLKVHLREQGIRHDVIDACLAMPGNDDLTLLVKRAEALSGFL 574

Query: 582 SSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            +  G   L   KR   IL   E K+  E S    P++   +AE+ L+A +      I  
Sbjct: 575 KTDDGTNLLQGFKRANNILTQAEAKDGVEYSFGADPKFAETDAERALFAALETAEAAIGP 634

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
           ++  + +      + ++  PI+ FF+ V VN D+  +R NRL++L  I+     V ++ +
Sbjct: 635 ALQAEDFAAAMSAMAALRAPIDAFFETVQVNADNAVLRRNRLNMLHSIRATCARVADLTR 694

Query: 701 I 701
           I
Sbjct: 695 I 695


>gi|290511859|ref|ZP_06551227.1| glycyl-tRNA synthetase, beta subunit [Klebsiella sp. 1_1_55]
 gi|289775649|gb|EFD83649.1| glycyl-tRNA synthetase, beta subunit [Klebsiella sp. 1_1_55]
          Length = 689

 Score =  638 bits (1645), Expect = e-180,   Method: Composition-based stats.
 Identities = 204/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSENTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMIASSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  IP   +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIPSDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGQADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L     
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLMTLTA 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++  F  +R + +  D     D I ++L       +     +K
Sbjct: 506 EAIRLYGDKLTNPNTLDDVETFMLNRFRAWYQDMGFSIDTILSVLELRPTMPVDFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F S         + KR+  IL+   K+   ++  + P  L   AE+ L   ++   
Sbjct: 566 AVTYFRSQPDAASLAAANKRVSNILS---KRVDVLNDSVHPALLTERAEQELAFKLAVVR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             I+    + +Y      L ++ EP++ FF+ V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 DRIKPLCQNLQYQDALIELAALREPVDEFFENVMVNAEDKDVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|145632310|ref|ZP_01788045.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae 3655]
 gi|144987217|gb|EDJ93747.1| glycyl-tRNA synthetase beta subunit [Haemophilus influenzae 3655]
          Length = 688

 Score =  637 bits (1643), Expect = e-180,   Method: Composition-based stats.
 Identities = 208/720 (28%), Positives = 343/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 KGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L +   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLRDKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK      
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYLPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDKLPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLLLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRVPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|269137370|ref|YP_003294070.1| glycyl-tRNA synthetase, beta subunit [Edwardsiella tarda EIB202]
 gi|267983030|gb|ACY82859.1| glycyl-tRNA synthetase, beta subunit [Edwardsiella tarda EIB202]
 gi|304557471|gb|ADM40135.1| Glycyl-tRNA synthetase beta chain [Edwardsiella tarda FL6-60]
          Length = 689

 Score =  637 bits (1643), Expect = e-180,   Method: Composition-based stats.
 Identities = 204/720 (28%), Positives = 340/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     A+  +      L   G+ + ++  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDIEWFAAPRRLALKVAALNAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L    +
Sbjct: 65  QPDREIEKRGPAIAQAFDADGKPTKAAEGWARGCGISVDQADRL--STDKGEWLLYRALQ 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +D+L T V  A+ ++P PK MRW  + +      ++RP+ ++  +L +E      
Sbjct: 123 KGQRAQDLLPTRVANALSRLPIPKLMRWGDSDT-----QFVRPVHTVTLLLGSE-----S 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  +P   +  GHRF       + S D Y +  LE   V+ D + R+  I  DA  
Sbjct: 173 IPATILGVPSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYDARKALIKRDAEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAARIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI + D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGKLLPNFIFVANIDSKDA-QQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++G+  ++  RI  L   IAQ I ADV +  RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E   PR   + +PT+ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEADEVAVALNEQYMPRFAGDALPTSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL   + I + P G KDP+ALRRA LG++RI++E K+ + L    ++   
Sbjct: 450 CAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             ++ ++ 
Sbjct: 510 LYGDKLSNANVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K    ++ ++    L   AE RL A +      + 
Sbjct: 570 FRTLPEAATLAAANKRVSNILA---KSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY +    L ++ +P++ FF+QV+V  DD +VR NRL+LL  ++++ L V ++ 
Sbjct: 627 PLFADGRYQEALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADIS 686


>gi|238917996|ref|YP_002931510.1| glycyl-tRNA synthetase subunit beta [Edwardsiella ictaluri 93-146]
 gi|259511924|sp|C5B995|SYGB_EDWI9 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238867564|gb|ACR67275.1| glycyl-tRNA synthetase, beta subunit, putative [Edwardsiella
           ictaluri 93-146]
          Length = 689

 Score =  637 bits (1642), Expect = e-180,   Method: Composition-based stats.
 Identities = 203/720 (28%), Positives = 340/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     A+  +      L   G+ + ++  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDIEWFAAPRRLALKVAALNAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L    +
Sbjct: 65  QPDREIEKRGPAIAQAFDAEGKPTKAAEGWARGCGISVDQAERL--STDKGEWLLYRALQ 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +D+L  +V  A+ ++P PK MRW  + +      ++RP+ ++  +L +E      
Sbjct: 123 KGQRAQDLLPALVASALSRLPIPKLMRWGDSDT-----QFVRPVHTVTLLLGSE-----S 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  +P   +  GHRF       + S D Y +  LE   V+ D + R+  I  DA  
Sbjct: 173 IPATILGVPSDRVIRGHRFMGEAEFTLDSADQYPQILLERGKVIADYDARKALIKRDAEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAARIGGVADLSDSLLEEVTSLVEWPVVLTARFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI + D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGKLLPNFIFVANIDSKDA-QQIIAGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++G+  ++  RI  L   IAQ I ADV +  RA
Sbjct: 339 -------KQRLEDNLPRLE--SVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E   PR   + +PT+ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL   + I + P G KDP+ALRRA LG++RI++E K+ + L    ++   
Sbjct: 450 CAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             ++ ++ 
Sbjct: 510 LYGDKLGNASVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K    ++ ++    L   AE RL A +      + 
Sbjct: 570 FRTLPEAATLAAANKRVSNILA---KSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY +    L ++ +P++ FF+QV+V  DD +VR NRL+LL  ++++ L V ++ 
Sbjct: 627 PLFADGRYQEALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADIS 686


>gi|307246733|ref|ZP_07528803.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255718|ref|ZP_07537522.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260170|ref|ZP_07541880.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852433|gb|EFM84668.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861395|gb|EFM93385.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865816|gb|EFM97694.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 689

 Score =  636 bits (1641), Expect = e-180,   Method: Composition-based stats.
 Identities = 210/720 (29%), Positives = 346/720 (48%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+FH ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFHQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLSLDLEDLVRKSAV 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDRSLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|293412993|ref|ZP_06655661.1| glycyl-tRNA synthetase [Escherichia coli B354]
 gi|291468640|gb|EFF11133.1| glycyl-tRNA synthetase [Escherichia coli B354]
          Length = 689

 Score =  636 bits (1641), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTMLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|153007867|ref|YP_001369082.1| glycyl-tRNA synthetase subunit beta [Ochrobactrum anthropi ATCC
           49188]
 gi|151559755|gb|ABS13253.1| glycyl-tRNA synthetase, beta subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 764

 Score =  636 bits (1641), Expect = e-180,   Method: Composition-based stats.
 Identities = 335/762 (43%), Positives = 444/762 (58%), Gaps = 61/762 (8%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ KAA DL  ++   L E G+ Y+    YWTP RL L ++GL+
Sbjct: 1   MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVEAGLTYEAATPYWTPRRLTLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  E+  GP V A ++AI GFLR  GL  ++   +  DPKKGD Y+A L KP R  
Sbjct: 61  VRSKDVHEDIKGPSVTAPEQAIQGFLRKAGLTDVAQAHVHSDPKKGDFYVAHLTKPGRAA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  +VP  I+  PWPKSMRW    +   +  W+RPL+SILC    E  +  +ID D+
Sbjct: 121 EEIVAELVPQTIRNFPWPKSMRWGAASARPGSLRWVRPLQSILCTFGPETEETVVIDFDV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             I  GN+TYGHRF +   PIKV+  + Y+  LE+A V+LD E R+  I  DAH LA A 
Sbjct: 181 DGIKSGNVTYGHRFLSDGQPIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFAS 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EG 297
           GLELVED  LLEE+ GLVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +    
Sbjct: 241 GLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGEAE 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILVSNI A DGG  I  GN +VV ARL DAL+FW  DQ++LP+L  L  SA KF
Sbjct: 301 ALSNKFILVSNIAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDLPDLDKLVASAEKF 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
            LDL KPLDQRMARLD L+V FHAK+GTQG RV RIR L  +IA L+ AD  L  RA VL
Sbjct: 361 GLDLKKPLDQRMARLDALNVTFHAKLGTQGARVERIRELAAQIAPLVGADPKLAARAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TE+V EFPELQG +G++YA+LQ E+ +   AIEEH KP+GP + VP N +S+ V
Sbjct: 421 AKADLTTEVVGEFPELQGAMGRKYALLQGEDEAVAAAIEEHYKPQGPSDVVPKNPVSVAV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE------- 530
           +LADKLDTL+ FWAI+EKP+GSKDP+ALRRA LG+IR++L  +   PL            
Sbjct: 481 ALADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALK 540

Query: 531 ----DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPEND--------------NLLTIV- 571
                + L  F          D D   D+  A+   E                +LL+ + 
Sbjct: 541 EGQVQRKLREFETKLAGENSGDIDGEQDVDNALASYEKQVRAEAEASSEPVLADLLSFLH 600

Query: 572 -----------DLIKHLNEFF---------------------SSAKGEKFLLSAKRIFQI 599
                           ++                        +   G+  L   KR   I
Sbjct: 601 DRFKVHLKEEGARYDAIDAVLSPEADNLLLVARRLEALIVFINEEDGKNLLAGTKRAANI 660

Query: 600 LAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICE 659
           LA EEKK  +++  +S   L    EK L+  ++      + ++  + ++     L  +  
Sbjct: 661 LAAEEKKGTKVADSVSASLLHEAEEKALFEAVTLASQDAEAAIAREDFNGAMLALAKLRG 720

Query: 660 PIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           P++ FF++VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 PVDTFFEKVLVNDEDENVRANRLALLDQIRAATGKVADFSKI 762


>gi|331685221|ref|ZP_08385807.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H299]
 gi|331077592|gb|EGI48804.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H299]
          Length = 689

 Score =  636 bits (1641), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNTNVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAASLAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|307251102|ref|ZP_07533026.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306856932|gb|EFM89064.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 689

 Score =  636 bits (1640), Expect = e-180,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 345/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGNKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDRSLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|229844013|ref|ZP_04464154.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae 6P18H1]
 gi|229813007|gb|EEP48695.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae 6P18H1]
          Length = 688

 Score =  636 bits (1640), Expect = e-180,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 344/720 (47%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLNGIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK      
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYLPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDKLPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLLLDLEDLVKKSAA 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNQNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI+L       +  AEK L   +    T +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADAAIGEINLTA----CVEPAEKALAEAVLALRTEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 626 PLIAQGDYTTVLDKLANLRVPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 685


>gi|52426011|ref|YP_089148.1| glycyl-tRNA synthetase subunit beta [Mannheimia succiniciproducens
           MBEL55E]
 gi|81825482|sp|Q65R47|SYGB_MANSM RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|52308063|gb|AAU38563.1| GlyS protein [Mannheimia succiniciproducens MBEL55E]
          Length = 689

 Score =  636 bits (1640), Expect = e-180,   Method: Composition-based stats.
 Identities = 209/722 (28%), Positives = 349/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ ++ +  P RL + +  L+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLTFEKVQWFAAPRRLAVKVLNLATS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPTKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERLATD--KGEWLVHRATI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  ++++  IV  ++  +P PK MRW           ++RP+ ++  +L  E     +
Sbjct: 123 EGQPTKNLMLDIVTRSLANLPIPKMMRWGDKTE-----QFVRPVHTVSLLLGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  I  G    GHRF      ++   D Y + L++   V+ D   RR  IL D+  
Sbjct: 173 IEGEILGIASGRTIRGHRFLGEAEFQIAHADEYPQILKDKGSVIADFNERRAIILADSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            ASA+G     + DLL+E+  LVE+  V   +F++++L +P E +  T+K +QK F    
Sbjct: 233 KASALGGVADIEDDLLDEVTSLVEFPNVLTATFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           + G L   FI VSNI  +D    I++GN +VV  RL DA  F+  D+             
Sbjct: 293 KNGKLLPHFIFVSNINPTD-PTPIIEGNEKVVRPRLSDAEFFFNTDK------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L  +IA  I AD A  +RA
Sbjct: 339 -------KQRLEDLLPRLET--VLFQQQLGTLLDKTKRIQALAGEIATQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   +N+P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDNLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L++ ++    
Sbjct: 450 SSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLAEIVKKSTA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFADRLTNQNVVDDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS +I    LL   EK L   +    + + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KIEGEISSKIDRTLLLEPEEKALAEQVLALQSELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y    D L  + E I+ FFD+V+VN +D ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PLFAKGEYQPALDRLAGLREVIDNFFDKVMVNAEDEKLRQNRQAILNTLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|144897875|emb|CAM74739.1| glycyl-tRNA synthetase beta chain [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 690

 Score =  636 bits (1640), Expect = e-180,   Method: Composition-based stats.
 Identities = 265/722 (36%), Positives = 401/722 (55%), Gaps = 55/722 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M + LLEI+SEEIPARMQ +AAEDL  ++   L + G+ +   R Y TP RL L ++GL 
Sbjct: 1   MAELLLEIFSEEIPARMQARAAEDLLRMVTEGLGKNGLTFDGARSYVTPRRLVLVIEGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  EE+ GPRVGA ++A+ GFL STG+        K+D  KG+ Y A++ K  R  
Sbjct: 61  TAGPDVSEEKRGPRVGAPEQAMAGFLSSTGMALEQLE--KRDTGKGEFYFAIINKKGRPT 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D  K ++  A+   PWPKS RW           W+RPL+SILC+         ++ +  
Sbjct: 119 VDAAKEVIEAAMADFPWPKSQRWG-----TETVRWVRPLQSILCLFAG-----AVVPVSF 168

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN++ GHRF AP    V     Y   L  A V+LDP  RR+AIL  A   A+A G
Sbjct: 169 GPITAGNVSRGHRFLAPADFTVTDFADYSTKLAAAKVVLDPVERRHAILRQAEEAAAAAG 228

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
             L  D  LL E+ GLVE+  V +G  D K++ +P+E++  +++++QK F     +G LA
Sbjct: 229 FALRADDGLLAEVTGLVEYPNVMIGVIDDKFMAVPQEVLITSMRSHQKYFSLLKADGSLA 288

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F++VSN++ +D GAAI  GN RV+ ARL DA  FW  D+                   
Sbjct: 289 PRFLVVSNMETNDNGAAITAGNQRVLRARLSDAAFFWDTDR------------------- 329

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLID-ADVALVDRAIVLSK 419
             + LD R+ +L     +F+AK+GT  ++V R+ +L + +   ++ A     +RA  L+K
Sbjct: 330 -KQRLDSRLPKLAER--LFYAKLGTMADKVERMAILARHLTAFVEAAHADEAERAARLAK 386

Query: 420 ADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSL 479
           ADL TE+V EFPELQG +G+ YA+   E  +  DAI  H  P+GP ++VPT  ++I  +L
Sbjct: 387 ADLSTEMVGEFPELQGIMGRYYALNDGETPAVADAIAGHYAPQGPSDSVPTAPLTICAAL 446

Query: 480 ADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-------- 531
           ADK+D+L+ F+AI+EKP+GSKDP+ALRRA LG+IR+++EN + +PL   ++         
Sbjct: 447 ADKIDSLVGFFAIDEKPTGSKDPFALRRAALGVIRLVVENNLRLPLFAVLQFAHSLYKPG 506

Query: 532 ----------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPEN-DNLLTIVDLIKHLNEF 580
                      +L+ FF DR+K++L ++ +RHDL+ AI    + D+L+ ++  +  L +F
Sbjct: 507 VLSADPRMVANDLLDFFADRMKVHLKEKGVRHDLVNAIFALGDEDDLVRLLARVDALADF 566

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
            SS  G   L++ +R   I+ IEEKK+    +       L    E+ L   ++     + 
Sbjct: 567 LSSDDGSNLLIAYRRAANIVKIEEKKDGTSFAGPADVSRLKEPEEQALGQALAPARDALA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            ++  + +      L  +  P++ FFD+V VN D  E+R NRL LL  I   +  V +  
Sbjct: 627 HALKAEDFADAMAALAQLRRPVDAFFDKVTVNADQAELRVNRLKLLAEIGAAMGEVADFS 686

Query: 700 KI 701
           K+
Sbjct: 687 KV 688


>gi|218550844|ref|YP_002384635.1| glycyl-tRNA synthetase subunit beta [Escherichia fergusonii ATCC
           35469]
 gi|218707192|ref|YP_002414711.1| glycyl-tRNA synthetase subunit beta [Escherichia coli UMN026]
 gi|293407181|ref|ZP_06651105.1| glycyl-tRNA synthetase beta subunit [Escherichia coli FVEC1412]
 gi|298382930|ref|ZP_06992525.1| glycyl-tRNA synthetase beta subunit [Escherichia coli FVEC1302]
 gi|300898729|ref|ZP_07117041.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 198-1]
 gi|331665183|ref|ZP_08366084.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA143]
 gi|331675048|ref|ZP_08375805.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA280]
 gi|226737054|sp|B7NEL0|SYGB_ECOLU RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|226737056|sp|B7LTH3|SYGB_ESCF3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|218358385|emb|CAQ91032.1| glycine tRNA synthetase, beta subunit [Escherichia fergusonii ATCC
           35469]
 gi|218434289|emb|CAR15211.1| glycine tRNA synthetase, beta subunit [Escherichia coli UMN026]
 gi|284923591|emb|CBG36687.1| glycine-tRNA synthetase, beta subunit [Escherichia coli 042]
 gi|291425992|gb|EFE99026.1| glycyl-tRNA synthetase beta subunit [Escherichia coli FVEC1412]
 gi|298276766|gb|EFI18284.1| glycyl-tRNA synthetase beta subunit [Escherichia coli FVEC1302]
 gi|300357647|gb|EFJ73517.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 198-1]
 gi|323975029|gb|EGB70138.1| glycyl-tRNA synthetase beta subunit [Escherichia coli TW10509]
 gi|324007365|gb|EGB76584.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 57-2]
 gi|324111897|gb|EGC05877.1| glycyl-tRNA synthetase beta subunit [Escherichia fergusonii B253]
 gi|331057693|gb|EGI29679.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA143]
 gi|331067957|gb|EGI39355.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA280]
          Length = 689

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|170766599|ref|ZP_02901052.1| glycyl-tRNA synthetase, beta subunit [Escherichia albertii TW07627]
 gi|170124037|gb|EDS92968.1| glycyl-tRNA synthetase, beta subunit [Escherichia albertii TW07627]
          Length = 689

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAQAQPDREIEKRGPAIAQAFDAEGNPTKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQADRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|165977240|ref|YP_001652833.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|238687522|sp|B0BSX5|SYGB_ACTPJ RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|165877341|gb|ABY70389.1| glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 689

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 344/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVDDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDRSLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDSFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|306816088|ref|ZP_07450226.1| glycyl-tRNA synthetase subunit beta [Escherichia coli NC101]
 gi|305850484|gb|EFM50941.1| glycyl-tRNA synthetase subunit beta [Escherichia coli NC101]
          Length = 689

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGNVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|331655194|ref|ZP_08356193.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli M718]
 gi|331047209|gb|EGI19287.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli M718]
          Length = 689

 Score =  635 bits (1639), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEALSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|170682940|ref|YP_001745846.1| glycyl-tRNA synthetase subunit beta [Escherichia coli SMS-3-5]
 gi|218702324|ref|YP_002409953.1| glycyl-tRNA synthetase subunit beta [Escherichia coli IAI39]
 gi|226737052|sp|B7NP55|SYGB_ECO7I RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|226737055|sp|B1LJC0|SYGB_ECOSM RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|170520658|gb|ACB18836.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli SMS-3-5]
 gi|218372310|emb|CAR20175.1| glycine tRNA synthetase, beta subunit [Escherichia coli IAI39]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGESEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|300937166|ref|ZP_07152019.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 21-1]
 gi|300457752|gb|EFK21245.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 21-1]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L E   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGESEFTIDNADQYPEILRERGRVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|325499117|gb|EGC96976.1| glycyl-tRNA synthetase subunit beta [Escherichia fergusonii ECD227]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RI++E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRILVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|320639879|gb|EFX09473.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7 str.
           G5101]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +        ++ KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAVANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|15833696|ref|NP_312469.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7 str.
           Sakai]
 gi|26250200|ref|NP_756240.1| glycyl-tRNA synthetase subunit beta [Escherichia coli CFT073]
 gi|91213072|ref|YP_543058.1| glycyl-tRNA synthetase subunit beta [Escherichia coli UTI89]
 gi|110643806|ref|YP_671536.1| glycyl-tRNA synthetase subunit beta [Escherichia coli 536]
 gi|117625841|ref|YP_859164.1| glycyl-tRNA synthetase subunit beta [Escherichia coli APEC O1]
 gi|168746896|ref|ZP_02771918.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753378|ref|ZP_02778385.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168759650|ref|ZP_02784657.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168765973|ref|ZP_02790980.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168772480|ref|ZP_02797487.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168779709|ref|ZP_02804716.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785430|ref|ZP_02810437.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168797396|ref|ZP_02822403.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|191170372|ref|ZP_03031925.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli F11]
 gi|195935089|ref|ZP_03080471.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808060|ref|ZP_03250397.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812785|ref|ZP_03254114.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820866|ref|ZP_03261186.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399717|ref|YP_002273044.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|215488843|ref|YP_002331274.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326136|ref|ZP_03442220.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218560634|ref|YP_002393547.1| glycyl-tRNA synthetase subunit beta [Escherichia coli S88]
 gi|218691848|ref|YP_002400060.1| glycyl-tRNA synthetase subunit beta [Escherichia coli ED1a]
 gi|227883725|ref|ZP_04001530.1| glycyl-tRNA synthetase subunit beta [Escherichia coli 83972]
 gi|237703329|ref|ZP_04533810.1| glycyl-tRNA synthetase subunit beta [Escherichia sp. 3_2_53FAA]
 gi|254795515|ref|YP_003080352.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224877|ref|ZP_05939158.1| glycine tRNA synthetase, beta subunit [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254224|ref|ZP_05946757.1| glycine tRNA synthetase, beta subunit [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284935|ref|YP_003501753.1| Glycyl-tRNA synthetase beta subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|300971418|ref|ZP_07171453.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 45-1]
 gi|300976958|ref|ZP_07173693.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 200-1]
 gi|301047087|ref|ZP_07194188.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 185-1]
 gi|331649389|ref|ZP_08350475.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli M605]
 gi|54039662|sp|P67031|SYGB_ECO57 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|54042277|sp|P67030|SYGB_ECOL6 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|123265949|sp|Q1R537|SYGB_ECOUT RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|123343488|sp|Q0TBP4|SYGB_ECOL5 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166227912|sp|A1AHA0|SYGB_ECOK1 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|226737051|sp|B7MER4|SYGB_ECO45 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238064849|sp|B5YVL1|SYGB_ECO5E RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|254781848|sp|B7ULB9|SYGB_ECO27 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|254781850|sp|B7N1L1|SYGB_ECO81 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|26110629|gb|AAN82814.1|AE016768_232 Glycyl-tRNA synthetase beta chain [Escherichia coli CFT073]
 gi|13363916|dbj|BAB37865.1| glycine tRNA synthetase beta subunit [Escherichia coli O157:H7 str.
           Sakai]
 gi|91074646|gb|ABE09527.1| glycine tRNA synthetase beta subunit [Escherichia coli UTI89]
 gi|110345398|gb|ABG71635.1| glycyl-tRNA synthetase beta chain [Escherichia coli 536]
 gi|115514965|gb|ABJ03040.1| glycyl-tRNA synthetase subunit beta [Escherichia coli APEC O1]
 gi|187771698|gb|EDU35542.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018299|gb|EDU56421.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|189002608|gb|EDU71594.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189359259|gb|EDU77678.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189364795|gb|EDU83214.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369719|gb|EDU88135.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189374282|gb|EDU92698.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189380084|gb|EDU98500.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190909180|gb|EDV68766.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli F11]
 gi|208727861|gb|EDZ77462.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734062|gb|EDZ82749.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740989|gb|EDZ88671.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161117|gb|ACI38550.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209755198|gb|ACI75911.1| glycine tRNA synthetase beta subunit [Escherichia coli]
 gi|209755200|gb|ACI75912.1| glycine tRNA synthetase beta subunit [Escherichia coli]
 gi|209755202|gb|ACI75913.1| glycine tRNA synthetase beta subunit [Escherichia coli]
 gi|209755204|gb|ACI75914.1| glycine tRNA synthetase beta subunit [Escherichia coli]
 gi|209755206|gb|ACI75915.1| glycine tRNA synthetase beta subunit [Escherichia coli]
 gi|215266915|emb|CAS11358.1| glycine tRNA synthetase, beta subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|217322357|gb|EEC30781.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218367403|emb|CAR05185.1| glycine tRNA synthetase, beta subunit [Escherichia coli S88]
 gi|218429412|emb|CAR10231.1| glycine tRNA synthetase, beta subunit [Escherichia coli ED1a]
 gi|226902593|gb|EEH88852.1| glycyl-tRNA synthetase subunit beta [Escherichia sp. 3_2_53FAA]
 gi|227839305|gb|EEJ49771.1| glycyl-tRNA synthetase subunit beta [Escherichia coli 83972]
 gi|254594915|gb|ACT74276.1| glycine tRNA synthetase, beta subunit [Escherichia coli O157:H7
           str. TW14359]
 gi|281180603|dbj|BAI56933.1| glycyl-tRNA synthetase beta subunit [Escherichia coli SE15]
 gi|290764808|gb|ADD58769.1| Glycyl-tRNA synthetase beta subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|294489492|gb|ADE88248.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli IHE3034]
 gi|300301004|gb|EFJ57389.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 185-1]
 gi|300308428|gb|EFJ62948.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 200-1]
 gi|300411252|gb|EFJ94790.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 45-1]
 gi|307555663|gb|ADN48438.1| glycine tRNA synthetase beta subunit [Escherichia coli ABU 83972]
 gi|307628640|gb|ADN72944.1| glycyl-tRNA synthetase subunit beta [Escherichia coli UM146]
 gi|315285316|gb|EFU44761.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 110-3]
 gi|315294114|gb|EFU53466.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 153-1]
 gi|315300121|gb|EFU59359.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 16-3]
 gi|320191385|gb|EFW66035.1| Glycyl-tRNA synthetase beta chain [Escherichia coli O157:H7 str.
           EC1212]
 gi|320645042|gb|EFX14066.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H- str.
           493-89]
 gi|320650309|gb|EFX18792.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H- str.
           H 2687]
 gi|320655884|gb|EFX23807.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661664|gb|EFX29079.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666688|gb|EFX33671.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323189399|gb|EFZ74681.1| glycyl-tRNA synthetase beta subunit [Escherichia coli RN587/1]
 gi|323949802|gb|EGB45686.1| glycyl-tRNA synthetase beta subunit [Escherichia coli H252]
 gi|323954897|gb|EGB50677.1| glycyl-tRNA synthetase beta subunit [Escherichia coli H263]
 gi|324014233|gb|EGB83452.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 60-1]
 gi|326337437|gb|EGD61272.1| Glycyl-tRNA synthetase beta chain [Escherichia coli O157:H7 str.
           1044]
 gi|326339962|gb|EGD63769.1| Glycyl-tRNA synthetase beta chain [Escherichia coli O157:H7 str.
           1125]
 gi|330909621|gb|EGH38135.1| glycyl-tRNA synthetase beta chain [Escherichia coli AA86]
 gi|331041887|gb|EGI14031.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli M605]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|331659874|ref|ZP_08360812.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA206]
 gi|331053089|gb|EGI25122.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA206]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGESEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|293417006|ref|ZP_06659643.1| glycyl-tRNA synthetase [Escherichia coli B185]
 gi|291431582|gb|EFF04567.1| glycyl-tRNA synthetase [Escherichia coli B185]
          Length = 689

 Score =  635 bits (1638), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEHIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|320193929|gb|EFW68562.1| Glycyl-tRNA synthetase beta chain [Escherichia coli WV_060327]
          Length = 689

 Score =  635 bits (1637), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|188493970|ref|ZP_03001240.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli 53638]
 gi|188489169|gb|EDU64272.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli 53638]
          Length = 689

 Score =  635 bits (1637), Expect = e-180,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVAMNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFTEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|222035273|emb|CAP78018.1| glycyl-tRNA synthetase beta chain [Escherichia coli LF82]
 gi|312948124|gb|ADR28951.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 689

 Score =  635 bits (1637), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGESEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|300920443|ref|ZP_07136877.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 115-1]
 gi|300412576|gb|EFJ95886.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 115-1]
          Length = 689

 Score =  635 bits (1637), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|319899206|ref|YP_004159299.1| glycyl-tRNA synthetase beta chain [Bartonella clarridgeiae 73]
 gi|319403170|emb|CBI76729.1| glycyl-tRNA synthetase beta chain [Bartonella clarridgeiae 73]
          Length = 742

 Score =  635 bits (1637), Expect = e-179,   Method: Composition-based stats.
 Identities = 335/738 (45%), Positives = 451/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPA MQ +AA DL   +   L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MPDLLLELFSEEIPAHMQRRAASDLKKCVTDKLVNAGLSYKAACEYWTPRRLTLNIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP+  EER GP   + ++ ID FLR+TGL  IS   I  D KKGD Y+A   K  RL 
Sbjct: 61  KSSPDVHEERKGPNAQSPQQVIDAFLRTTGLNDISKVHITHDDKKGDFYIAKTTKKGRLA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PW KSMRW    +   A  WIR L++ILC+  +   +  II   +
Sbjct: 121 EEIIADILPDIIRNFPWQKSMRWGQESAKSGALRWIRSLQNILCVFGSAIGETHIIPFTV 180

Query: 181 KEIPCGNITYGHRFHAPHP-IKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +    I+V+  D Y+  LE   V+LD E R++ IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSNGKSIQVRRFDDYVTQLENHKVILDAERRKDIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR--EG 297
           GLELVEDK LLEE+ GLVEW  V M +FDK +L +P E+IRLTI+T+QKCFVTR R  + 
Sbjct: 241 GLELVEDKALLEEVAGLVEWPVVLMSTFDKTFLNIPPEIIRLTIQTHQKCFVTRKRGDKS 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILV+NI A+D G  I +GNS+VV ARL DAL+FW+ DQ NLPN++ L+ SA K 
Sbjct: 301 KLSNYFILVANILANDKGIEISKGNSKVVNARLSDALYFWQTDQCNLPNITHLESSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A+L+ L+V FHAK+GTQG +V RI  L + IA L+ AD  L  RA +L
Sbjct: 361 DLDLNKPLDQRIAQLNYLNVTFHAKLGTQGAKVERIAALTQIIAPLVKADSILAKRAAIL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL TEIV EFPELQG IG++YA+LQ E+    +AIE+H KP GP + +P   I+ITV
Sbjct: 421 AKADLQTEIVGEFPELQGLIGRKYALLQGEDPRVAEAIEDHYKPLGPKDRIPCEPIAITV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ----- 532
           +LADK+DTLI FW INEKP+ SKDPYALRRA LG+IR++L N   I L            
Sbjct: 481 ALADKIDTLIGFWFINEKPTSSKDPYALRRAALGVIRLMLLNDWKISLMPLFHQAMNFLL 540

Query: 533 -----------------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFH+RLK YL D   RHD+IEA+L  +
Sbjct: 541 QQKIQYATSETEATQLQNISVEKTENIVLDLLTFFHERLKGYLKDEGARHDIIEAVLTKD 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
           +D++L I   ++ L  F ++  G   L++ KR   IL  E KK   I  ++ P+  +   
Sbjct: 601 SDDILLIARRVEALTFFINTNDGNSLLIAVKRAINILENETKKGTTIINKVRPELFIETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY    +    I + +           L  + +PI  FF++V VN  +  +R NRL+
Sbjct: 661 EKQLYQTTIETEKKIADHIHVTELSSTLSSLLLLKKPINEFFEKVFVNDGNINIRTNRLA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL+ I+ +   V +  K+
Sbjct: 721 LLERIRIVTQNVADFSKL 738


>gi|310816494|ref|YP_003964458.1| glycyl-tRNA synthetase, beta subunit [Ketogulonicigenium vulgare
           Y25]
 gi|308755229|gb|ADO43158.1| glycyl-tRNA synthetase, beta subunit [Ketogulonicigenium vulgare
           Y25]
          Length = 690

 Score =  635 bits (1637), Expect = e-179,   Method: Composition-based stats.
 Identities = 273/723 (37%), Positives = 395/723 (54%), Gaps = 55/723 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D L+E++SEEIPARMQ +AA+DL  ++   L E G+ Y+    + TP RL L L GL+
Sbjct: 1   MADLLIELFSEEIPARMQTRAADDLRRLVTDGLVEAGLTYEGAGAFSTPRRLVLTLSGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S    EER GPR  A + A+ GFLR+TGL             +GD Y AV  KP R  
Sbjct: 61  AQSRAVREERKGPRTNAPEAALQGFLRATGLTVDQL------DVRGDTYFAVTEKPGRAA 114

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++  A++  PWPKSMRW + +       W+RPL SI+C+L      ++++ +D+
Sbjct: 115 PEIIAEVLTSAVRNFPWPKSMRWGSGN-----LRWVRPLHSIICLL-----DDQVVPVDI 164

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T GHRF AP  I V     Y   L+ A V+L  + R + I  DA   A A G
Sbjct: 165 DGIVAGNTTRGHRFMAPGVITVTGFADYEEKLQAARVMLRADQRADTIWTDATNAAFAKG 224

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VEDK LL E+ GLVEW  V MG   + +L LP E+++ +++ +QK F  R       
Sbjct: 225 LEVVEDKGLLAEVAGLVEWPVVLMGPIGEAFLGLPPEVLQTSMREHQKFFSLRNPATGRI 284

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+NI  +D GA I+QGN +V+AARL DA  FW+ D   +                
Sbjct: 285 EAFITVANILTADDGATILQGNGKVLAARLSDARFFWENDLRTVSRAG------------ 332

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+   A L   +V FH ++G+Q +R++RI  + + +A +  AD      A  + KA
Sbjct: 333 ----LEGMAAGL--ANVTFHNRLGSQTDRIARIEAMARALAPVTGADADEAALAARVVKA 386

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G  YA     + +  +A + H +P GP + VP   +S TV+LA
Sbjct: 387 DLRSEMVGEFPELQGTMGGYYARAAGLSDAVANACKGHYQPLGPDDAVPHEAVSATVALA 446

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQ------------- 527
           DKLDTL  FWA++EKP+GSKDP+ALRRA LG+IR++L N + +PL               
Sbjct: 447 DKLDTLTGFWAMDEKPTGSKDPFALRRAALGVIRLVLGNGLRLPLRDTLAAPLAANFAAS 506

Query: 528 ------FIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILR-PENDNLLTIVDLIKHLNEF 580
                     +NL+ FFHDRLK++L D  + HD+I+A L  P ND+L  +V   + L  F
Sbjct: 507 GTAGETAPVAENLLGFFHDRLKVFLKDEGLSHDVIDACLAMPGNDDLDLLVRRARALQAF 566

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
             +  GE  +   KR   IL   E K+  E S    P +   E E+ L+A ++     I 
Sbjct: 567 LKTDDGENLVQGFKRANNILTQAEAKDGVEYSFGADPAFAEDEVERALFAALTRAEGQIT 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            ++  + +      + ++  PI+ FF  V VN ++  VR NRL+LL  I+ I L V ++ 
Sbjct: 627 PAIAAEDFAGAMAAMAALRAPIDAFFAGVQVNAENAIVRRNRLNLLGQIRTICLQVADLS 686

Query: 700 KIV 702
           ++V
Sbjct: 687 RLV 689


>gi|303250056|ref|ZP_07336258.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253488|ref|ZP_07535359.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651119|gb|EFL81273.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859167|gb|EFM91209.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 689

 Score =  635 bits (1637), Expect = e-179,   Method: Composition-based stats.
 Identities = 208/720 (28%), Positives = 346/720 (48%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRR+ LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRSALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGNKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS+EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISIEIDRTLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDHLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|301020273|ref|ZP_07184391.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 69-1]
 gi|300398850|gb|EFJ82388.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 69-1]
          Length = 689

 Score =  634 bits (1636), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLSHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPAVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|323966028|gb|EGB61469.1| glycyl-tRNA synthetase beta subunit [Escherichia coli M863]
 gi|327251210|gb|EGE62903.1| glycyl-tRNA synthetase beta subunit [Escherichia coli STEC_7v]
          Length = 689

 Score =  634 bits (1636), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESQD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|307257903|ref|ZP_07539658.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863590|gb|EFM95518.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 689

 Score =  634 bits (1636), Expect = e-179,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 344/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKEIEKRGPAVSAAFDADGKPTKAAEGWARGCGITVDQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE   V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVELPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLSLDLEDLVRKSAV 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDCTLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|323179478|gb|EFZ65045.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 1180]
          Length = 689

 Score =  634 bits (1636), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L ++V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPSMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|16131430|ref|NP_418016.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|89110454|ref|AP_004234.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|157163035|ref|YP_001460353.1| glycyl-tRNA synthetase subunit beta [Escherichia coli HS]
 gi|170018211|ref|YP_001723165.1| glycyl-tRNA synthetase subunit beta [Escherichia coli ATCC 8739]
 gi|170083068|ref|YP_001732388.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|194435847|ref|ZP_03067950.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli 101-1]
 gi|238902648|ref|YP_002928444.1| glycine tRNA synthetase, beta subunit [Escherichia coli BW2952]
 gi|253771606|ref|YP_003034437.1| glycyl-tRNA synthetase subunit beta [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038744|ref|ZP_04872800.1| glycyl-tRNA synthetase beta subunit [Escherichia sp. 1_1_43]
 gi|254163483|ref|YP_003046591.1| glycyl-tRNA synthetase subunit beta [Escherichia coli B str.
           REL606]
 gi|256025713|ref|ZP_05439578.1| glycyl-tRNA synthetase subunit beta [Escherichia sp. 4_1_40B]
 gi|300930911|ref|ZP_07146276.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 187-1]
 gi|300950351|ref|ZP_07164281.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 116-1]
 gi|301028172|ref|ZP_07191443.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 196-1]
 gi|301646007|ref|ZP_07245913.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 146-1]
 gi|307140250|ref|ZP_07499606.1| glycyl-tRNA synthetase subunit beta [Escherichia coli H736]
 gi|312972165|ref|ZP_07786339.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 1827-70]
 gi|331644271|ref|ZP_08345400.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H736]
 gi|586056|sp|P00961|SYGB_ECOLI RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166980038|sp|A8A616|SYGB_ECOHS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|189082267|sp|B1IZN4|SYGB_ECOLC RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|229470697|sp|B1X8H5|SYGB_ECODH RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|259511923|sp|C4ZXE9|SYGB_ECOBW RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|466697|gb|AAB18536.1| glycine-tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789982|gb|AAC76583.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|85676485|dbj|BAE77735.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K12
           substr. W3110]
 gi|157068715|gb|ABV07970.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli HS]
 gi|169753139|gb|ACA75838.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli ATCC 8739]
 gi|169890903|gb|ACB04610.1| glycine tRNA synthetase, beta subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|194425390|gb|EDX41374.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli 101-1]
 gi|226839250|gb|EEH71273.1| glycyl-tRNA synthetase beta subunit [Escherichia sp. 1_1_43]
 gi|238861373|gb|ACR63371.1| glycine tRNA synthetase, beta subunit [Escherichia coli BW2952]
 gi|242379077|emb|CAQ33878.1| glycyl-tRNA synthetase, beta subunit, subunit of glycyl-tRNA
           synthetase [Escherichia coli BL21(DE3)]
 gi|253322650|gb|ACT27252.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975384|gb|ACT41055.1| glycyl-tRNA synthetase subunit beta [Escherichia coli B str.
           REL606]
 gi|253979540|gb|ACT45210.1| glycyl-tRNA synthetase subunit beta [Escherichia coli BL21(DE3)]
 gi|260447424|gb|ACX37846.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli DH1]
 gi|299878749|gb|EFI86960.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 196-1]
 gi|300450317|gb|EFK13937.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 116-1]
 gi|300461230|gb|EFK24723.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 187-1]
 gi|301075759|gb|EFK90565.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 146-1]
 gi|310334542|gb|EFQ00747.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 1827-70]
 gi|315138136|dbj|BAJ45295.1| glycyl-tRNA synthetase subunit beta [Escherichia coli DH1]
 gi|315618402|gb|EFU98989.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 3431]
 gi|323934887|gb|EGB31269.1| glycyl-tRNA synthetase beta [Escherichia coli E1520]
 gi|323939541|gb|EGB35749.1| glycyl-tRNA synthetase beta subunit [Escherichia coli E482]
 gi|323959375|gb|EGB55035.1| glycyl-tRNA synthetase beta subunit [Escherichia coli H489]
 gi|323971318|gb|EGB66560.1| glycyl-tRNA synthetase beta subunit [Escherichia coli TA007]
 gi|331036565|gb|EGI08791.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H736]
 gi|332345527|gb|AEE58861.1| glycyl-tRNA synthetase beta subunit GlyS [Escherichia coli UMNK88]
          Length = 689

 Score =  634 bits (1635), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFTEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|74314188|ref|YP_312607.1| glycyl-tRNA synthetase subunit beta [Shigella sonnei Ss046]
 gi|157156177|ref|YP_001465034.1| glycyl-tRNA synthetase subunit beta [Escherichia coli E24377A]
 gi|218697274|ref|YP_002404941.1| glycyl-tRNA synthetase subunit beta [Escherichia coli 55989]
 gi|256020906|ref|ZP_05434771.1| glycyl-tRNA synthetase subunit beta [Shigella sp. D9]
 gi|293453868|ref|ZP_06664287.1| glycyl-tRNA synthetase [Escherichia coli B088]
 gi|300925635|ref|ZP_07141500.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 182-1]
 gi|307314647|ref|ZP_07594247.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli W]
 gi|332282126|ref|ZP_08394539.1| glycyl-tRNA synthetase subunit beta [Shigella sp. D9]
 gi|123759516|sp|Q3YVU0|SYGB_SHISS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166980037|sp|A7ZTA5|SYGB_ECO24 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|254781849|sp|B7L6X3|SYGB_ECO55 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|73857665|gb|AAZ90372.1| glycine tRNA synthetase, beta subunit [Shigella sonnei Ss046]
 gi|157078207|gb|ABV17915.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli E24377A]
 gi|218354006|emb|CAV00497.1| glycine tRNA synthetase, beta subunit [Escherichia coli 55989]
 gi|291321994|gb|EFE61425.1| glycyl-tRNA synthetase [Escherichia coli B088]
 gi|300418253|gb|EFK01564.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 182-1]
 gi|306905860|gb|EFN36384.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli W]
 gi|315062845|gb|ADT77172.1| glycine tRNA synthetase, beta subunit [Escherichia coli W]
 gi|323166949|gb|EFZ52688.1| glycyl-tRNA synthetase beta subunit [Shigella sonnei 53G]
 gi|323174217|gb|EFZ59845.1| glycyl-tRNA synthetase beta subunit [Escherichia coli LT-68]
 gi|323182714|gb|EFZ68116.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 1357]
 gi|323376564|gb|ADX48832.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli KO11]
 gi|324116562|gb|EGC10479.1| glycyl-tRNA synthetase beta subunit [Escherichia coli E1167]
 gi|332104478|gb|EGJ07824.1| glycyl-tRNA synthetase subunit beta [Shigella sp. D9]
          Length = 689

 Score =  634 bits (1635), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|24114835|ref|NP_709345.1| glycyl-tRNA synthetase subunit beta [Shigella flexneri 2a str. 301]
 gi|30065154|ref|NP_839325.1| glycyl-tRNA synthetase subunit beta [Shigella flexneri 2a str.
           2457T]
 gi|110807772|ref|YP_691292.1| glycyl-tRNA synthetase subunit beta [Shigella flexneri 5 str. 8401]
 gi|191165233|ref|ZP_03027076.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli B7A]
 gi|193061668|ref|ZP_03042765.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli E22]
 gi|194427395|ref|ZP_03059944.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli B171]
 gi|209921023|ref|YP_002295107.1| glycyl-tRNA synthetase subunit beta [Escherichia coli SE11]
 gi|260846727|ref|YP_003224505.1| glycine tRNA synthetase, beta subunit [Escherichia coli O103:H2
           str. 12009]
 gi|260858046|ref|YP_003231937.1| glycine tRNA synthetase, beta subunit [Escherichia coli O26:H11
           str. 11368]
 gi|260870289|ref|YP_003236691.1| glycine tRNA synthetase, beta subunit [Escherichia coli O111:H-
           str. 11128]
 gi|300815213|ref|ZP_07095438.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 107-1]
 gi|300822039|ref|ZP_07102182.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 119-7]
 gi|300902750|ref|ZP_07120705.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 84-1]
 gi|301304611|ref|ZP_07210720.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 124-1]
 gi|309797584|ref|ZP_07691973.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 145-7]
 gi|331670392|ref|ZP_08371231.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA271]
 gi|331679639|ref|ZP_08380309.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H591]
 gi|81839217|sp|Q83J38|SYGB_SHIFL RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|123146479|sp|Q0SY78|SYGB_SHIF8 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238064850|sp|B6I3C9|SYGB_ECOSE RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|24054068|gb|AAN45052.1| glycine tRNA synthetase, beta subunit [Shigella flexneri 2a str.
           301]
 gi|30043415|gb|AAP19136.1| glycine tRNA synthetase, beta subunit [Shigella flexneri 2a str.
           2457T]
 gi|110617320|gb|ABF05987.1| glycine tRNA synthetase, beta subunit [Shigella flexneri 5 str.
           8401]
 gi|190904635|gb|EDV64341.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli B7A]
 gi|192932458|gb|EDV85055.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli E22]
 gi|194414435|gb|EDX30708.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli B171]
 gi|209914282|dbj|BAG79356.1| glycyl-tRNA synthase beta subunit [Escherichia coli SE11]
 gi|257756695|dbj|BAI28197.1| glycine tRNA synthetase, beta subunit [Escherichia coli O26:H11
           str. 11368]
 gi|257761874|dbj|BAI33371.1| glycine tRNA synthetase, beta subunit [Escherichia coli O103:H2
           str. 12009]
 gi|257766645|dbj|BAI38140.1| glycine tRNA synthetase, beta subunit [Escherichia coli O111:H-
           str. 11128]
 gi|281602927|gb|ADA75911.1| Glycyl-tRNA synthetase beta subunit [Shigella flexneri 2002017]
 gi|300405178|gb|EFJ88716.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 84-1]
 gi|300525402|gb|EFK46471.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 119-7]
 gi|300532105|gb|EFK53167.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 107-1]
 gi|300840089|gb|EFK67849.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 124-1]
 gi|308118854|gb|EFO56116.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 145-7]
 gi|315254088|gb|EFU34056.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 85-1]
 gi|320201420|gb|EFW76001.1| Glycyl-tRNA synthetase beta chain [Escherichia coli EC4100B]
 gi|323153887|gb|EFZ40121.1| glycyl-tRNA synthetase beta subunit [Escherichia coli EPECa14]
 gi|323160673|gb|EFZ46612.1| glycyl-tRNA synthetase beta subunit [Escherichia coli E128010]
 gi|323944544|gb|EGB40615.1| glycyl-tRNA synthetase beta [Escherichia coli H120]
 gi|324017914|gb|EGB87133.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 117-3]
 gi|331062454|gb|EGI34374.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli TA271]
 gi|331072811|gb|EGI44136.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli H591]
 gi|332749993|gb|EGJ80405.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri K-671]
 gi|332750151|gb|EGJ80562.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri 4343-70]
 gi|332751419|gb|EGJ81822.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri 2747-71]
 gi|332764240|gb|EGJ94477.1| glycyl-tRNA synthetase, &beta subunit [Shigella flexneri 2930-71]
 gi|332996373|gb|EGK16000.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri VA-6]
 gi|332996921|gb|EGK16540.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri K-272]
 gi|332997029|gb|EGK16645.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri K-218]
 gi|333012812|gb|EGK32189.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri K-304]
 gi|333013392|gb|EGK32764.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri K-227]
          Length = 689

 Score =  634 bits (1635), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|237728873|ref|ZP_04559354.1| glycyl-tRNA synthetase subunit beta [Citrobacter sp. 30_2]
 gi|226909495|gb|EEH95413.1| glycyl-tRNA synthetase subunit beta [Citrobacter sp. 30_2]
          Length = 689

 Score =  634 bits (1635), Expect = e-179,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGIAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAETLLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + S D Y   L     V+ D   R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDSADQYPEILRERGKVIADYAERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVHTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKDPIQ-IISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K    ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KSEETLNDRVNAATLKEPEEIALAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + EP++ FF++V+VNV+D+++R NRLS+L+ ++ + L V
Sbjct: 623 DKLEPVFAAGRYQEALVELAELREPVDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|327395920|dbj|BAK13342.1| glycyl-tRNA synthetase beta chain GlyS [Pantoea ananatis AJ13355]
          Length = 689

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 203/726 (27%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  +   L    + +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAEAFAAQVTAELDAANLNHGEVSWFAAPRRLALKIAS 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP V       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSASQPDREVEKRGPAVAAAFDAEGNATKAAEGWARGNGITVEQAERL--STDKGEWLVY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             +      + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAQVKGEAAQALLPGMVATALSKLPVPKLMRWGDSD-----VQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILN 230
            +++I   +  I    +  GHRF     I +++ D Y   LE+   V+ D + R+  I  
Sbjct: 169 GDELIPATILGIKSDRVIRGHRFMGESEITLENADQYPDVLEKRGQVIADYQVRKAMIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAARRLGGVADLSDSLLEEVTSLVEWPVVLTATFEEKFLKVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                EG L   FI V+NI++SD    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDAEGNLLPNFIFVTNIESSD-PQQIISGNEKVVRPRLADAEFFFDTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQKELGSLRDKTDRIQALAGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 SPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGSKLSNANAVNDVIDFMLGRFRSWYQEEGHSIDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLDEAAALAAANKRVSNILA---KSTEPLNDSVQASLLKENEEIQLATFVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN +D  VR NRL+LL  ++ + L V
Sbjct: 623 SKLQPYFAEGRYQDALIELAQLREAVDNFFDKVMVNAEDEAVRINRLTLLSKLRGLFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|323139039|ref|ZP_08074098.1| glycyl-tRNA synthetase, beta subunit [Methylocystis sp. ATCC 49242]
 gi|322395699|gb|EFX98241.1| glycyl-tRNA synthetase, beta subunit [Methylocystis sp. ATCC 49242]
          Length = 725

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 306/716 (42%), Positives = 412/716 (57%), Gaps = 63/716 (8%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPARMQ +AA+DL  ++   L E G+ Y+    Y TP RL L + GL 
Sbjct: 1   MPDLLLELFSEEIPARMQRQAADDLRRLVTNALVERGLTYEGASAYATPRRLALQVVGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  EER GPRVGA   AI GFL+S GL ++   +I+KD K  + YLAV+ +P    
Sbjct: 61  GRQPDVREERKGPRVGAPDAAIQGFLKSAGLASLDQARIEKDKKGAEFYLAVIERPGAET 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
             VL  I+P  ++  PWPKSMRW        +  W+RPL SI+     E     ++  ++
Sbjct: 121 IQVLAEILPGIVKGFPWPKSMRWGAASERTDSLRWVRPLHSIVATFGPETETPDVVPFEV 180

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  GN T+GHRF AP  I V+  + Y   LE A V++DPE RR+ IL+DA  LA A G
Sbjct: 181 DGIIAGNTTHGHRFMAPAAIHVKRFEDYAMSLERARVVIDPERRRDIILHDAKDLAFAQG 240

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LELVED  LLEE+ GLVEW    MGSFD+ +L +P E+IR TI+ NQKCFV R ++G L 
Sbjct: 241 LELVEDAGLLEEVAGLVEWPVTLMGSFDESFLSIPPEVIRATIRVNQKCFVLR-KDGKLT 299

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSNI+ASD GA IV GN RV+AARL DA  F++ D                    
Sbjct: 300 NRFILVSNIEASDHGATIVAGNQRVIAARLSDAKFFYETD-------------------- 339

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           L   L+ R+ +LD   +VFH K+GTQGERV RI  L +++A ++ AD     RA  L KA
Sbjct: 340 LKTKLEDRLPKLDQ--IVFHEKLGTQGERVKRIAALARELAPIVGADPDKAARAATLCKA 397

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G  YA  Q E+ S  +A  EH KP+G  +  P + +SI V+LA
Sbjct: 398 DLVSEMVGEFPELQGLMGSYYASAQGEDPSVANACYEHYKPQGQGDYAPKDPVSIAVALA 457

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-------- 532
           DKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IRIILEN++ +      + Q        
Sbjct: 458 DKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRIILENELRLQALPIFDCQYNVFSFHG 517

Query: 533 ----------------NLILFFHDRLKLYLHDRDIRHDLIEAIL--------------RP 562
                           +L+ FF DRLK+YL D+  R+DLI+A L                
Sbjct: 518 KTLKETSEGMVGTSAISLLEFFIDRLKVYLRDKGARYDLIDAALGAVAFDESEEETASAA 577

Query: 563 ENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISL--EISPQYLL 620
             D+LL I   ++ L++F ++  G+  L   KR   IL  EEKK+   +     +P   +
Sbjct: 578 LQDDLLMITKKVEALDKFLATDDGKNLLAGYKRAVNILKAEEKKDGPRAYYHRHAPNLRV 637

Query: 621 LEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDRE 676
              E +L A I+       E ++ + +      L  + +P++ FF+ V VN D+ +
Sbjct: 638 EPQEHKLAAAIARAREETTEKLEKEDFAGAMRSLAKLRDPVDAFFEHVTVNADNAD 693


>gi|218556118|ref|YP_002389031.1| glycyl-tRNA synthetase subunit beta [Escherichia coli IAI1]
 gi|226737053|sp|B7M3I1|SYGB_ECO8A RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|218362886|emb|CAR00520.1| glycine tRNA synthetase, beta subunit [Escherichia coli IAI1]
          Length = 689

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLTSD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|260563481|ref|ZP_05833967.1| glycyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|265990534|ref|ZP_06103091.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265999600|ref|ZP_05467081.2| glycyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|260153497|gb|EEW88589.1| glycyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|263001318|gb|EEZ13893.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094883|gb|EEZ18621.1| glycyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408438|gb|ADZ65503.1| glycyl-tRNA synthetase subunit beta [Brucella melitensis M28]
 gi|326538154|gb|ADZ86369.1| glycyl-tRNA synthetase, beta subunit [Brucella melitensis M5-90]
          Length = 761

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 335/759 (44%), Positives = 442/759 (58%), Gaps = 74/759 (9%)

Query: 17  MQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVG 76
           MQ KAA DL  ++   L + G+ Y+    YWTP RL L ++GL+  S +  E+  GP V 
Sbjct: 1   MQRKAAGDLKKMITDGLVDAGLTYEAATAYWTPRRLALDIRGLTVRSKDVHEDIKGPSVS 60

Query: 77  AGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVP 136
           A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  ED++  +VP  I+  P
Sbjct: 61  APEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAAEDIVAELVPQTIRNFP 120

Query: 137 WPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHA 196
           WPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+  I  GN+TYGHRF +
Sbjct: 121 WPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDVDGIKSGNVTYGHRFLS 180

Query: 197 PH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIG 255
               IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A GLELVED  LLEE+ G
Sbjct: 181 DGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFASGLELVEDDGLLEEVSG 240

Query: 256 LVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV---------------LA 300
           LVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +                  L+
Sbjct: 241 LVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDASRLASPAPQHEEIQALS 300

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++LP+L  L  SA KF LD
Sbjct: 301 NKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLD 360

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           L KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+ AD  L  RA VL+KA
Sbjct: 361 LKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKA 420

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP + VP N +S+ V+LA
Sbjct: 421 DLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGPSDVVPKNPVSVAVALA 480

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   PL               
Sbjct: 481 DKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALQEGQ 540

Query: 530 EDQNLILF-----------------FHDRLKLYLHD------------------------ 548
             + L  F                   + L  Y  +                        
Sbjct: 541 MQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEASCGPVLADLLSFFHDRF 600

Query: 549 ------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAI 602
                    R+D I+A+L PE DNLL +   ++ L  F +   G+  L  AKR   ILA 
Sbjct: 601 KVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDGKNLLAGAKRAANILAA 660

Query: 603 EEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIE 662
           EEKK  +++  + P  L    EK L+  ++     + E++  + ++     L  +  P++
Sbjct: 661 EEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVD 720

Query: 663 IFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 IFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 759


>gi|88801020|ref|ZP_01116569.1| Glycyl-tRNA synthetase, beta subunit [Reinekea sp. MED297]
 gi|88776223|gb|EAR07449.1| Glycyl-tRNA synthetase, beta subunit [Reinekea sp. MED297]
          Length = 681

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 204/714 (28%), Positives = 358/714 (50%), Gaps = 54/714 (7%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            DFL+E+ +EE+P +         +  +I  L++ G+ +++  ++  P RL L LK L  
Sbjct: 4   ADFLIELGTEELPPKALRMLKNAFAEGIIERLQKAGLSFEDSERFAAPRRLALTLKNLEL 63

Query: 62  HSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIE 121
             P++ +ER GP   A  +AI+GF +S G+  +   +++ D  KG   +    KP +   
Sbjct: 64  KQPDEEQERKGPNAKAPAQAIEGFAKSCGVTVVDLEELETD--KGTWLVYRGVKPGKPTA 121

Query: 122 DVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLK 181
           ++L  IV   +  +P PK MRW           ++RP+K +L +L      ++++  ++ 
Sbjct: 122 ELLPEIVQQTLDALPIPKRMRWGARRD-----EFVRPVKWLLMLL-----GDEVVPAEIY 171

Query: 182 EIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHRLASAVG 240
            +  GN++ GHRFHAP  I + S   Y   L  E  V+     R   I  +  ++A+  G
Sbjct: 172 GVSSGNLSRGHRFHAPKDIAITSASAYQETLRAEGKVMASYGERHKLIEAEVKKVAAEKG 231

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           +  V D DLL+E+  L EW    +G F++++L +P E +  +++ +QK F T   EG + 
Sbjct: 232 VVPVIDADLLDEVTALNEWPVALVGQFEERFLEVPAEALMSSMEEHQKYFPTVDAEGNIQ 291

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI ++NI++ D    +++GN +V+  RL DA  FW+ D+                   
Sbjct: 292 PYFIFIANIESKD-PQVVIEGNEKVIRPRLSDAAFFWETDK------------------- 331

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L  R+A L    V F  ++G+  ++V RI+ +   IA  IDA V+  +RA  L+KA
Sbjct: 332 -KTKLADRVASLKT--VKFQEQLGSVFDKVERIQKIAGHIAGQIDASVSEAERAAYLAKA 388

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL T++V EF +LQG  G+ YA+   E  +  +AI E  KP G  + +P ++  + V+LA
Sbjct: 389 DLVTDMVFEFTDLQGIAGRYYALADGEPEAVAEAILEQYKPAGAGDALPESREGMAVALA 448

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--------- 531
           D+LD L   + I + P+G+KDP+ALRRA LG++RI++E ++D+ L+  +           
Sbjct: 449 DRLDNLSGLFGIGQPPTGTKDPFALRRAALGVLRIVVERELDLDLADLVAFAADQHNKLP 508

Query: 532 ------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAK 585
                  +++ +  DR   +  D  IR ++ +A+          I   ++ + EF    +
Sbjct: 509 KRDAVVNDVVHYALDRFSAWYADEGIRTEVFQAVRALNLTKPYDIDLRVRAVAEFSKLDQ 568

Query: 586 GEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHK 645
            E    + KR+   L+   K   +I  EI         E  L   +      +  ++   
Sbjct: 569 AEALAAANKRVSNFLS---KVEGDIPTEIDVARFEESVEGDLLKALDGVEAKVSAAVQSS 625

Query: 646 RYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            Y    + L ++ + ++ FFD+V+V  DD  VR+NRL+LL  ++ + + V ++ 
Sbjct: 626 DYRTALNELSTLRDAVDAFFDKVMVMADDDNVRNNRLALLSKLRGLFVQVADIS 679


>gi|309703962|emb|CBJ03305.1| glycine-tRNA synthetase, beta subunit [Escherichia coli ETEC
           H10407]
          Length = 689

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 DPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFTEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|194431308|ref|ZP_03063601.1| glycyl-tRNA synthetase, beta subunit [Shigella dysenteriae 1012]
 gi|194420763|gb|EDX36839.1| glycyl-tRNA synthetase, beta subunit [Shigella dysenteriae 1012]
 gi|320182075|gb|EFW56980.1| Glycyl-tRNA synthetase beta chain [Shigella boydii ATCC 9905]
 gi|332085078|gb|EGI90258.1| glycyl-tRNA synthetase beta subunit [Shigella boydii 5216-82]
 gi|332085634|gb|EGI90798.1| glycyl-tRNA synthetase beta subunit [Shigella dysenteriae 155-74]
          Length = 689

 Score =  633 bits (1634), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL +  V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQI--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|114319177|ref|YP_740860.1| glycine--tRNA ligase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225571|gb|ABI55370.1| glycyl-tRNA synthetase beta chain [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 693

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 218/728 (29%), Positives = 350/728 (48%), Gaps = 65/728 (8%)

Query: 1   MPD----FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYL 56
           M +     L+EI +EE+P     +        ++  L++  + +  +  Y TP RL L +
Sbjct: 1   MAESTRTLLIEIGTEELPPVALPRLEAAFRDGVVQGLEQAELGHGPVHSYATPRRLALQV 60

Query: 57  KGLSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVY 109
           + L     +K  ER GP +       G   KA +GF RS G       +++    KG   
Sbjct: 61  EALQARQEDKAIERRGPALNVAFDDHGRPTKAAEGFARSCGATVEQLERLE--TPKGTWL 118

Query: 110 LAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAE 169
                +P R   ++L  IV  ++ ++P PK MRW +  +      ++RP+  I+ +L A+
Sbjct: 119 AWRGVQPGRAATELLPDIVNQSLSRLPIPKRMRWGSGQAT-----FVRPVHWIVFLLGAD 173

Query: 170 DAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAI 228
                ++   L ++  G  T GHRFHAP PI++ S D Y   L  E  V    E RR  I
Sbjct: 174 -----VVPATLMDVTSGRTTRGHRFHAPEPIELASADDYAERLRGEGRVEASFEARRERI 228

Query: 229 LNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQK 288
                RLA       + D+ LL+E+  LVEW    +GSFD  +L +PEE +  +++ +QK
Sbjct: 229 RRGVLRLAEQEQGVAIMDEGLLDEVTALVEWPVPLVGSFDPGFLEVPEEALISSMQGHQK 288

Query: 289 CFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLS 348
            F  R ++G L   FI V+NI++ D    +  GN RV+  RL DA  FW++D+       
Sbjct: 289 YFPVRGQDGQLLPLFITVANIESRD-PDQVRSGNERVIRPRLADADFFWQQDR------- 340

Query: 349 SLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADV 408
                         +PL  R+A L    V+F  ++GT  ++  R+  L +++A  +D D 
Sbjct: 341 -------------KRPLIDRLADLK--GVIFQKQLGTLYDKTQRVAHLAEQLAVEMDHDP 385

Query: 409 ALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENV 468
           A V RA  L++ DL TE+V EFPELQG +G+ YA+   E  +  DAI EH +PR   E +
Sbjct: 386 APVARAAWLARCDLGTEMVGEFPELQGIMGRYYALHDGEPKAVADAILEHYRPRYAGEAI 445

Query: 469 PTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF 528
           P       +++A++ DTL   +AI   P+G KDP+ALRRA LG++R ++E ++ + L   
Sbjct: 446 PATPAGRLLAIAERADTLAGIFAIGLAPTGDKDPFALRRAALGLMRTLIEGELPLDLEGL 505

Query: 529 IED---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDL 573
           +                 + +  F  +RL+ Y  ++ I  +L EA+L       L     
Sbjct: 506 LGRAAVLLPEGIAGRSIAEEVYDFCLERLRGYYQEQGIGAELFEAVLAVRPRCPLDFHRR 565

Query: 574 IKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISD 633
           +     F    + E    + KRI  IL    K    +   ++   L   AE+ L   +  
Sbjct: 566 LLACRRFAGLPEAEALAAANKRIGNILR---KAGETVPDTVASAQLKEPAEQALARSLEA 622

Query: 634 FGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIIL 693
               +Q  +    Y    + L  + EP++ FFD +LV  +D  VR NRL+LL+ I+ + L
Sbjct: 623 TREQLQPRLAEGDYAGALEGLARLREPVDTFFDDILVMAEDPGVRVNRLALLKAIQALFL 682

Query: 694 IVINVQKI 701
            + +V ++
Sbjct: 683 EIADVSRL 690


>gi|307133195|ref|YP_003885211.1| glycine tRNA synthetase, subunit beta [Dickeya dadantii 3937]
 gi|306530724|gb|ADN00655.1| glycine tRNA synthetase, beta subunit [Dickeya dadantii 3937]
          Length = 689

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 209/724 (28%), Positives = 340/724 (46%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L   G+ YQ++  +  P RL L + G
Sbjct: 1   MTDKTFLVEIGTEELPPKALRTLAESFAANFTAELDAAGLGYQSVNWFAAPRRLALKVAG 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQAERL--TTDKGEWLLF 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             +      + +L  +V  A+ K+P PK M W    +      ++RP+ ++  +L     
Sbjct: 119 RAQVKGEAAQALLPGMVSTALAKLPIPKLMHWGDKET-----QFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++   +  I       GHRF       + + D Y +  LE   VL D E R+  I  
Sbjct: 169 GDELVPGTVLGIDSARTIRGHRFMGEPEFTIDNADQYPQILLERGKVLADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEDAARNIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGKLMPNFIFVANIESKD-PQQIIAGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI  L   +A+ I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGTLRDKTDRIAALAGWVAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA   +E      A+ E  +PR   +++P+
Sbjct: 386 AKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDSEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG +RII+E ++ + L    E
Sbjct: 446 SPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNVNVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  + E    + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAEALAAANKRVSNILA---KSTETLNDSVQAALLKENEEIQLATYVTALT 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +       RY +    L  + EP++ FFD+V+VN DD++VR NRL+LL  ++N+ L V
Sbjct: 623 SKLAPWFAEGRYQEALGELAQLREPVDNFFDKVMVNADDQQVRINRLTLLNELRNLFLKV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|262273136|ref|ZP_06050953.1| glycyl-tRNA synthetase beta chain [Grimontia hollisae CIP 101886]
 gi|262222892|gb|EEY74200.1| glycyl-tRNA synthetase beta chain [Grimontia hollisae CIP 101886]
          Length = 693

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 205/730 (28%), Positives = 343/730 (46%), Gaps = 68/730 (9%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +FL+E+ +EE+P       AE  +      LKE  + ++ ++ Y TP RL L +  L
Sbjct: 1   MAKNFLIELGTEELPPTQLRTLAEAFAANFEQELKEAELAHEGIKWYATPRRLALKVSAL 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           +    +K+ E+ GP V       G   KA  G+ R  G++     ++  D  KG+  L  
Sbjct: 61  AEQQADKVVEKRGPAVSAAFDADGNPTKAAQGWARGCGIEVADADRMVTD--KGEWLLFK 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
                +  +D++  +   A+  +P  K MRW    +      +IRP+K++  +L      
Sbjct: 119 QEVKGQNTKDIVVALADKALANLPIAKPMRWGDKETL-----FIRPVKTLTILL-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILND 231
           +++++  +  +       GHRF       + + D Y   LE    V+ D E R+  I+ D
Sbjct: 169 DELVEGTIMGVGSTRTIRGHRFMGEAEFTIDNADQYPAILEERGKVIADYEARKATIIAD 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
           A + A  +G     + DL+EE+  LVEW  V   +F++K+L +P E +  T+K +QK F 
Sbjct: 229 AQKAAKQLGGVADLEDDLVEEVTSLVEWPVVLTATFEEKFLKVPSEALVYTMKGDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
             + +  L   FI VSNI++ +    +++GN +VV  RL DA  F+  D+          
Sbjct: 289 VYSEDKQLLPNFIFVSNIESKE-PRHVIEGNEKVVRPRLADAEFFFDTDR---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL  R+ +L+    +F  ++GT  ++  RI  L   IA  I ADV   
Sbjct: 338 ----------KRPLIDRLPQLETA--IFQKQLGTIKDKTDRITELAGYIADKIGADVEKA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +L+K DL T +V EF E QG +G  YA    E      A+ E   PR   + +P +
Sbjct: 386 KRAGLLAKCDLMTSMVFEFTETQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDELPGD 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
            +S  +++ADKLDT++  + I + P GS DP+ALRRA+LG++RII+E   D+ L+  +  
Sbjct: 446 GVSSALAMADKLDTIVGIFGIGQAPKGS-DPFALRRASLGVLRIIVEYGYDLDLTDLVAK 504

Query: 532 Q--------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIV 571
                                ++I F   R + +  D     D I+A+L           
Sbjct: 505 AKSLFANEDGSNRLTNENVEADVIEFMLGRFRAWYQDEGHSVDAIQAVLAMRPTQPADFD 564

Query: 572 DLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVI 631
             +K +  F S    E    + KR+  ILA   K + E+S  I+ + L+ +AEK L   +
Sbjct: 565 KRVKAVTHFRSLDAAESLAAANKRVGNILA---KFDGELSDTINSELLVEDAEKALADKV 621

Query: 632 SDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNI 691
           +     +        Y      L  + EP++ FFD V+V  +D  ++ NRL+LL  +++ 
Sbjct: 622 TAMVEALAPVFAAGDYQTALTQLAELREPVDTFFDNVMVMAEDEALKANRLALLNTLRSQ 681

Query: 692 ILIVINVQKI 701
            + V ++  +
Sbjct: 682 FMNVADISLL 691


>gi|261757637|ref|ZP_06001346.1| glycyl-tRNA synthetase [Brucella sp. F5/99]
 gi|261737621|gb|EEY25617.1| glycyl-tRNA synthetase [Brucella sp. F5/99]
          Length = 761

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 336/759 (44%), Positives = 443/759 (58%), Gaps = 74/759 (9%)

Query: 17  MQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVG 76
           MQ KAA DL  ++I  L + G+ Y+    YWTP RL L ++GL+  S +  E+  GP V 
Sbjct: 1   MQRKAAGDLKKMIIDGLVDAGLTYEAATAYWTPRRLALDIRGLTVRSKDVHEDIKGPSVS 60

Query: 77  AGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVP 136
           A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  ED++  +VP  I+  P
Sbjct: 61  APEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAAEDIVAELVPQTIRNFP 120

Query: 137 WPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHA 196
           WPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+  I  GN+TYGHRF +
Sbjct: 121 WPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDVDGIKSGNVTYGHRFLS 180

Query: 197 PH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIG 255
               IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A GLELVED  LLEE+ G
Sbjct: 181 DGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFASGLELVEDDGLLEEVSG 240

Query: 256 LVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV---------------LA 300
           LVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +                  L+
Sbjct: 241 LVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDASRLASPAPQHEEIQALS 300

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++LP+L  L  SA KF LD
Sbjct: 301 NKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLD 360

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           L KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+ AD  L  RA VL+KA
Sbjct: 361 LKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKA 420

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP + VP N +S+ V+LA
Sbjct: 421 DLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGPSDVVPKNPVSVAVALA 480

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   PL               
Sbjct: 481 DKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALQEGQ 540

Query: 530 EDQNLILF-----------------FHDRLKLYLHD------------------------ 548
             + L  F                   + L  Y  +                        
Sbjct: 541 MQRKLREFEAKLAAENSGGVDGEQDVDNALANYEKEIRAEAEASCGPVLADLLSFFHDRF 600

Query: 549 ------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAI 602
                    R+D I+A+L PE DNLL +   ++ L  F +   G+  L  AKR   ILA 
Sbjct: 601 KVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDGKNLLAGAKRAANILAA 660

Query: 603 EEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIE 662
           EEKK  +++  + P  L    EK L+  ++     + E++  + ++     L  +  P++
Sbjct: 661 EEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVD 720

Query: 663 IFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 IFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 759


>gi|157149175|ref|YP_001456493.1| glycyl-tRNA synthetase subunit beta [Citrobacter koseri ATCC
           BAA-895]
 gi|166227911|sp|A8ARE4|SYGB_CITK8 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|157086380|gb|ABV16058.1| hypothetical protein CKO_05015 [Citrobacter koseri ATCC BAA-895]
          Length = 689

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 342/726 (47%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAEALLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF     I + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKLIPATILGIQSDRVIRGHRFMGEPEITIDTADQYPQILLERGKVVADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARQIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYAADGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLKTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KSDEVLNDRVNAATLKEPEEIALALQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + EP++ FF++V+V VDD+++R NRLS+L  ++ + L V
Sbjct: 623 DKLEPVFAEGRYQEALVELAELREPVDTFFEKVMVMVDDKDLRINRLSMLAKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|300957594|ref|ZP_07169796.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 175-1]
 gi|300315662|gb|EFJ65446.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 175-1]
          Length = 689

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLENNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFTEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|291615654|ref|YP_003518396.1| GlyS [Pantoea ananatis LMG 20103]
 gi|291150684|gb|ADD75268.1| GlyS [Pantoea ananatis LMG 20103]
          Length = 689

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 202/726 (27%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  +   L    + +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAEAFAAQVTAELDAANLNHGEVSWFAAPRRLALKIAS 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP V       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSASQPDREVEKRGPAVAAAFDAEGNATKAAEGWARGNGITVEQAERL--STDKGEWLVY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             +      + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAQVKGEAAQALLPGMVATALSKLPVPKLMRWGDSD-----VQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILN 230
            +++I   +  I    +  GHRF     I +++ D Y   LE+   V+ D + R+  I  
Sbjct: 169 GDELIPATILGIKSDRVIRGHRFMGESEITLENADQYPDVLEKRGQVIADYQVRKAMIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAARRLGGVADLSDSLLEEVTSLVEWPVVLTATFEEKFLKVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++SD    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDAGGNLLPNFIFVTNIESSD-PQQIISGNEKVVRPRLADAEFFFDTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQKELGSLRDKTDRIQALAGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 SPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGSKLSNANAVNDVIDFMLGRFRSWYQEEGHSIDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLDEAAALAAANKRVSNILA---KSTEPLNDSVQASLLKENEEIQLATFVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN +D  VR NRL+LL  ++ + L V
Sbjct: 623 SKLQPYFAEGRYQDALIELAQLREAVDNFFDKVMVNAEDEAVRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|317046302|ref|YP_004113950.1| glycyl-tRNA synthetase subunit beta [Pantoea sp. At-9b]
 gi|316947919|gb|ADU67394.1| glycyl-tRNA synthetase, beta subunit [Pantoea sp. At-9b]
          Length = 689

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAEAFAAQVTAELDAAGLAHGEVNWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LAAAQPDREVEKRGPAIAAAFDANGNATKAAEGWARGNGITVDQAERL--STDKGEWLVY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             +      + +L  ++  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAQVKGESAQTLLPAMIATALSKLPIPKLMRWGASD-----VQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDL-EEAMVLLDPECRRNAILN 230
            +++I   +  I    +  GHRF     I +   D Y + L E   V+ D   R+  I  
Sbjct: 169 GDELIPATILGIQSDRVIRGHRFMGEPEITLDHADQYPQLLLERGKVVADYAARKAQIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA + A  +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEQAALKLGGNADLSDSLLEEVTSLVEWPVVLTATFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++SD    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQKELGTLRDKTDRIQALAGWIAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGSKLSNGNVVDDVIDFMLGRFRTWYQEEGHSVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEAATTLAAANKRVSNILA---KSTETLNDSVQASLLKENEEIQLATFVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN DD+ VR NRL+LL  ++ + L V
Sbjct: 623 SKLQPYFAEGRYQDALIELAQLRESVDNFFDKVMVNADDQAVRINRLTLLAQLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|83311749|ref|YP_422013.1| glycyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|123541640|sp|Q2W3X1|SYGB_MAGMM RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|82946590|dbj|BAE51454.1| Glycyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 688

 Score =  633 bits (1633), Expect = e-179,   Method: Composition-based stats.
 Identities = 280/720 (38%), Positives = 409/720 (56%), Gaps = 53/720 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M +FLLEI+SEEIPARMQ +AA+DL  ++   L + G+ +   R Y TP RL L ++GL 
Sbjct: 1   MAEFLLEIFSEEIPARMQARAADDLRGMVSDGLAKNGITFDAARSYVTPRRLVLVIEGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  EE+ GPRV +  +A++GFL+STG+      Q  +D  KG  Y AV+ +  R  
Sbjct: 61  LAGPDVSEEKRGPRVSSPAQAMEGFLKSTGMTVEQLEQ--RDTGKGVFYFAVINRKGRPT 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +VL+ +   A+   PWPKS RW       ++  W+RP++SIL +         I+ +  
Sbjct: 119 AEVLREVTEGAMATFPWPKSQRWGA-----NSIRWVRPIQSILALF-----DGSIVPVAF 168

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
                G++T GHRF AP P +V+    Y+  L  A V+LDP  RR+AIL  A  LA+A G
Sbjct: 169 GPATAGDMTAGHRFLAPEPFRVKDFADYLSKLRHAKVMLDPVERRHAILAGAEGLAAAEG 228

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           L+L  D  LL E+ GLVEW    +GS D K++ +P E++  +++ +QK F     +G LA
Sbjct: 229 LQLKADDGLLAEVTGLVEWPVPLVGSIDDKFMDVPAEVLITSMRAHQKYFSLLKADGSLA 288

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI++SN++  DGG A+V GN RV+ ARL DA  FW  D+                   
Sbjct: 289 PRFIVISNMETDDGGKAVVAGNQRVLRARLSDAKFFWDTDR------------------- 329

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
             + L+ R+ +L      F+A +GT  ++V RI  L   IA +I AD A+ +RA  L+KA
Sbjct: 330 -KQRLEARLPKLAER--TFYASLGTVADKVDRISALAGNIAGMIGADRAVAERAARLAKA 386

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL TE+V EFPELQG +G+ YA+   E     DAI  H  P+GP ++ PT  +S+ V+LA
Sbjct: 387 DLSTELVGEFPELQGLMGRYYALNDGETPEVADAIAAHYSPQGPGDSCPTAPVSVAVALA 446

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE---------- 530
           DK+D+L+ F+AINEKP+GSKDP+ALRRA LGIIR++LEN + +PLSQ I           
Sbjct: 447 DKIDSLVGFFAINEKPTGSKDPFALRRAALGIIRLVLENGLRLPLSQVIFLASGHYKANL 506

Query: 531 -------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPEN-DNLLTIVDLIKHLNEFFS 582
                    +L+ FF DRL + L ++ +RHDLI AI      D+L+ ++  ++ L  F  
Sbjct: 507 VNSPGEVANDLLNFFADRLAVALKEKGVRHDLITAIFSLGGEDDLVRLLKRVEALGAFLD 566

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNREI-SLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           S  G   L++ +R   I+ IEEKK+  I S     Q L  + EK L   +SD G  +  +
Sbjct: 567 SDDGANLLIAYRRAANIVRIEEKKDGTIFSGYADIQLLRQDEEKALEHALSDVGQAVSNA 626

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +      L  +  P++ FFD+V VN D+  +R NRL LL  I + +  + +  K+
Sbjct: 627 LVTEDFAAAMAALARLRRPVDAFFDKVTVNADEAPLRVNRLKLLAMIGSAMGRLADFSKV 686


>gi|46143625|ref|ZP_00134813.2| COG0751: Glycyl-tRNA synthetase, beta subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209267|ref|YP_001054492.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae L20]
 gi|166227908|sp|A3N3A1|SYGB_ACTP2 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|126098059|gb|ABN74887.1| Glycyl-tRNA synthetase beta chain [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 689

 Score =  633 bits (1632), Expect = e-179,   Method: Composition-based stats.
 Identities = 209/720 (29%), Positives = 346/720 (48%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L +  + ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQADLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +     
Sbjct: 65  QPSKEIEKRGPAVSAAFDADGKPTKAAEGWARGCGITVDQADRIATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++     +E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKINNVIRGHRFLGEREFTISHADEYLTALREKGMVVADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD A  +RA
Sbjct: 338 ------LKQRLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGNKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS+EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISIEIDRTLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|152978094|ref|YP_001343723.1| glycyl-tRNA synthetase subunit beta [Actinobacillus succinogenes
           130Z]
 gi|171472951|sp|A6VLE1|SYGB_ACTSZ RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|150839817|gb|ABR73788.1| glycyl-tRNA synthetase, beta subunit [Actinobacillus succinogenes
           130Z]
          Length = 689

 Score =  633 bits (1632), Expect = e-179,   Method: Composition-based stats.
 Identities = 208/722 (28%), Positives = 344/722 (47%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +F  EI +EE+P +   K A   +  +   LK+ G+ +  +  +  P RL + +  L+ +
Sbjct: 5   NFFAEIGTEELPPKALKKLATAFAENVENELKQAGLAFDKVEWFAAPRRLAVKVLNLAAN 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVDQAERLVTD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  ++++  I+  ++  +P PK+MRW   +       ++RP+ ++  +L  E     +
Sbjct: 123 EGQPTKNLMLDIIAKSLANLPIPKTMRWGDKN-----VQFVRPVHTVTLLLGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEE-AMVLLDPECRRNAILNDAHR 234
           I+ ++  I  G    GHRF      ++   D Y   LEE   V+ D   RR  IL  +  
Sbjct: 173 IEGEILGIASGRTIRGHRFLGEREFQISHADQYPSLLEEKGCVIADFNKRREMILTKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     + DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEDDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           +EG L   FI VSNI   D    I++GN +VV  RL DA  F+  D+             
Sbjct: 293 KEGKLLPHFIFVSNINPVD-PMPIIEGNEKVVRPRLSDAEFFFNTDK------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL    V+F  ++GT  ++  RI+ L  +IA  I AD A  +RA
Sbjct: 339 -------KQRLEDLLPRLQT--VLFQQQLGTLLDKTKRIQSLAGEIAGQIGADKAKAERA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   +N+P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDNLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L+  ++    
Sbjct: 450 SSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLSLDLADLVKKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVDDVVDFMLGRFRAWYQDGGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EI  EI    LL   EK L   +    + + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVAGEIRSEIDRTLLLEAEEKALAEQVLALQSELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y    D L  + E ++ FFD+V+VN +D ++R NR ++L  ++N+ L V ++ 
Sbjct: 627 PVFAKGDYQTALDRLACLREVVDNFFDKVMVNAEDEKLRQNRQAMLNVLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|293391259|ref|ZP_06635593.1| glycyl-tRNA synthetase beta subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951793|gb|EFE01912.1| glycyl-tRNA synthetase beta subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 693

 Score =  633 bits (1632), Expect = e-179,   Method: Composition-based stats.
 Identities = 211/727 (29%), Positives = 351/727 (48%), Gaps = 67/727 (9%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ ++N+  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATAFADNVQAELNQAGLAFENIEWFAAPRRLAVKVLALATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +   + 
Sbjct: 65  QPSKEIEKHGPAVSAAFDAEGNPTKAAEGWARGCGITVDQAERLASD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLADIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASGRTIRGHRFLGEREFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPLYE 292

Query: 295 R-----EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSS 349
           +     +G L   FI VSNI   D  +AI++GN +VV  RL DA  F+K D         
Sbjct: 293 KTEGDKDGKLLPHFIFVSNINPDD-PSAIIEGNEKVVRPRLTDAEFFFKTD--------- 342

Query: 350 LKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVA 409
                      L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A
Sbjct: 343 -----------LKQKLVDRLPRLET--VLFQQQLGTLRDKTDRIEQLAGEIAKQIGADEA 389

Query: 410 LVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
              RA +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P
Sbjct: 390 KAKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELP 449

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
            + ++ +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +
Sbjct: 450 KSLVASSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLV 509

Query: 530 EDQ---------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
           +                 +++ F   R + +  D  I  D+I+A+L             +
Sbjct: 510 KKSAALFGDKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARV 569

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
           + ++ F +    E    + KR+  ILA  +    EI+L       +  AEK L   +   
Sbjct: 570 RAVSHFRTLDSAEALAAANKRVANILAKADVAIGEINLTA----CVEPAEKALAEAVLAL 625

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
            T +Q  +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L 
Sbjct: 626 QTEVQPLIAKGEYTAVLDKLANLRTPVDNFFDNVMVNAEDPALRQNRLAILNTLQGLFLQ 685

Query: 695 VINVQKI 701
           V ++  +
Sbjct: 686 VADISLL 692


>gi|301328324|ref|ZP_07221428.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 78-1]
 gi|300845219|gb|EFK72979.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli MS 78-1]
          Length = 689

 Score =  633 bits (1632), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGGIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|68249510|ref|YP_248622.1| glycyl-tRNA synthetase subunit beta [Haemophilus influenzae
           86-028NP]
 gi|81336063|sp|Q4QLY5|SYGB_HAEI8 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|68057709|gb|AAX87962.1| Glycyl-tRNA synthetase beta chain [Haemophilus influenzae 86-028NP]
          Length = 722

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 210/754 (27%), Positives = 342/754 (45%), Gaps = 96/754 (12%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEWFAAPRRLAVKVLNLATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +   + 
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERIATD--KGEWLVHRTKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 KGQPTKNLLNDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF       +Q  D Y + L +   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASARTIRGHRFLGEKEFDIQHADQYPQLLRDKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D   AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGRLLPHFIFVSNINPED-PTAIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  R+ RL+   V+F  ++GT  ++  RI  L  +IA+ I AD A   RA
Sbjct: 338 ------LKQKLVDRLPRLET--VLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L+  I     
Sbjct: 450 SAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLNDIISKAFD 509

Query: 532 ----------------------------------------------QNLILFFHDRLKLY 545
                                                           ++ F   R + +
Sbjct: 510 LYKELDNERLRNAPIAKTRGGFSEYPEGYVSFFTRGDDLVPKQKILDEVVDFMLGRFRAW 569

Query: 546 LHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEK 605
             D  I  D+I+A+L             ++ ++ F +    E    + KR+  ILA    
Sbjct: 570 YQDEGIAVDVIQAVLARRPTRPADFDARVRAVSHFRTLDSAEALAAANKRVSNILAKAGA 629

Query: 606 KNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFF 665
              EI+L       +  AEK L   +    T +Q  +    Y  + D L ++  P++ FF
Sbjct: 630 AIGEINLTA----CVEPAEKALAEAVLALRTEVQPLIAQGDYTAVLDKLANLRAPVDSFF 685

Query: 666 DQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
           D V+VN +D  +R NRL++L  ++ + L V ++ 
Sbjct: 686 DNVMVNAEDPALRQNRLAILNTLQGLFLQVADIS 719


>gi|320175983|gb|EFW51056.1| Glycyl-tRNA synthetase beta chain [Shigella dysenteriae CDC
           74-1112]
          Length = 689

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTVELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|193068544|ref|ZP_03049506.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli E110019]
 gi|192958195|gb|EDV88636.1| glycyl-tRNA synthetase, beta subunit [Escherichia coli E110019]
          Length = 689

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAEFFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|303253230|ref|ZP_07339379.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248875|ref|ZP_07530887.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647912|gb|EFL78119.1| glycyl-tRNA synthetase subunit beta [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306854612|gb|EFM86803.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 689

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/720 (28%), Positives = 344/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLATA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKAD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLSLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVEDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +    T + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDRTLLVEAEEKALAEQVISLQTELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|149375623|ref|ZP_01893392.1| Glycyl-tRNA synthetase, beta subunit [Marinobacter algicola DG893]
 gi|149360025|gb|EDM48480.1| Glycyl-tRNA synthetase, beta subunit [Marinobacter algicola DG893]
          Length = 695

 Score =  632 bits (1631), Expect = e-179,   Method: Composition-based stats.
 Identities = 198/724 (27%), Positives = 344/724 (47%), Gaps = 62/724 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     ++  +  +   L+E G+ +  +  +  P RL + ++ 
Sbjct: 1   MATQDFLVELGTEELPPKALKPLSDAFTRGITHGLEEAGIQFGKVEAFAAPRRLAVRVRD 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L    P+K  E+ GP V       G   +A+ GF  S G+       ++ D  KG   + 
Sbjct: 61  LEDAQPDKPVEKRGPAVKAAFDDSGNPTRALTGFATSLGVTPDQLDTLETD--KGAWVVY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
              +  R   +++  +V  ++  +P PK MRW    +      ++RP+   + +      
Sbjct: 119 RTIEKGRPTVELMPELVDQSLAALPIPKRMRWGAHRT-----EFVRPVHWAILLF----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEE-AMVLLDPECRRNAILN 230
             K+ID  +  +  GN T GHRFH P  + V +   Y   L +   V+ D   RR  I +
Sbjct: 169 GNKVIDTPIMGLTPGNKTRGHRFHCPKSLIVPTPGDYEVVLRQEGYVIADFAERREQIRD 228

Query: 231 DAHRLASA-VGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKC 289
               +A    G + V D+DLL+E+  L EW    MG F++++L +P E +  ++K +QK 
Sbjct: 229 GVTAIAKKEAGGQAVIDEDLLDEVTALNEWPVPLMGRFEERFLEVPAEALISSMKEHQKY 288

Query: 290 FVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSS 349
           F   + +G +   FI V+N+++ D    ++ GN +V+  RL DA  F+  D+        
Sbjct: 289 FHVVSADGRMLPLFITVANLESKD-PQQVISGNEKVIRPRLSDAAFFYDTDR-------- 339

Query: 350 LKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVA 409
                          L+ R+ +L    +VF  K+G+  ++  R+  L KKIA  I +D  
Sbjct: 340 ------------KTRLEDRIDQLKP--IVFQDKLGSIYDKSVRVAALAKKIADAIGSDPV 385

Query: 410 LVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
           L +RA +L+K DL TE+V EF +LQG +G+ YA    EN     A+ E   PR   +++P
Sbjct: 386 LAERAAMLAKTDLVTEMVLEFTDLQGIMGQYYAANDGENEDVASALNEQYMPRFAGDDLP 445

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
                  V++AD++D+L+  + IN+ PSG++DP+ LRRA+LG++RII+E ++ + L    
Sbjct: 446 ATLTGCAVAIADRIDSLVGLFGINQPPSGTRDPFGLRRASLGVLRIIIERELPLDLQTLC 505

Query: 530 E--------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           E                 ++ +  +R + +  ++ I  ++  A+        L     +K
Sbjct: 506 EWAVEQHNSFTEPKVANTVVDYMLERFRAHYEEQGISAEVYLAVHARRPTRPLDFDRRVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F    +      + KR+  IL  +      I   I  + L  +AE  L   I    
Sbjct: 566 AVEAFRQLPEALALAGANKRVSNILTKQ--GGDSIGESIDSELLQDKAEITLADQIRQQA 623

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
                  +   Y      L S+ EP++ FFD+V+V  DD  VR+NRL++L  ++N+ L V
Sbjct: 624 DKALPLFEKGDYATALSSLASLREPVDNFFDEVMVMADDEAVRNNRLAMLNLLRNLFLRV 683

Query: 696 INVQ 699
            ++ 
Sbjct: 684 ADIS 687


>gi|163761029|ref|ZP_02168107.1| glycyl-tRNA synthetase subunit beta [Hoeflea phototrophica DFL-43]
 gi|162281810|gb|EDQ32103.1| glycyl-tRNA synthetase subunit beta [Hoeflea phototrophica DFL-43]
          Length = 788

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 329/786 (41%), Positives = 444/786 (56%), Gaps = 85/786 (10%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E+ SEEIPARMQ KAA DL   +   L + G+ Y+  R+YWTP RL L ++GL+
Sbjct: 1   MPDLLIELRSEEIPARMQRKAAGDLRKSVTDALVDAGLTYEAAREYWTPRRLTLDIRGLT 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             S +  EE  GP   A ++A+ GF+R  GL  IS+  +  DPKKGD Y+A + +P R  
Sbjct: 61  ARSKDVHEEIKGPSTKAPEQALAGFMRKAGLNDISEAHVHTDPKKGDFYVAHISRPGRDA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISA------------FSWIRPLKSILCILVA 168
           E ++  ++P  I+   WPKSMRW     P  +              W+RPL+SI+C    
Sbjct: 121 EVIIADVMPGIIRGFSWPKSMRWGAASMPKGSSYHGIEGKGSESLKWVRPLQSIICTFGP 180

Query: 169 EDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAI 228
           E  +  +I  ++  +  GN T GHRFHAP P  V+  D Y   LE A V+LD E R+  I
Sbjct: 181 ETEEPTVIAFEIDGLVAGNTTSGHRFHAPDPFTVRRFDDYADKLERARVVLDAERRKEII 240

Query: 229 LNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQK 288
           L+DA  LA A GLELVED+ LL+E+ GLVEW  V MG F++ +L +P+++IRLTIKTNQK
Sbjct: 241 LSDARNLAFASGLELVEDEGLLDEVSGLVEWPVVLMGEFEEDFLAIPDDIIRLTIKTNQK 300

Query: 289 CFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLS 348
           CFV R     L+N FILVSNI+ASD G  I  GN +VV ARL DAL+FW  DQ +LP+L 
Sbjct: 301 CFVLRRPGRGLSNKFILVSNIEASDAGKEIAYGNGKVVRARLSDALYFWNTDQADLPDLE 360

Query: 349 SLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADV 408
            L  SA K  LD+SKPLDQRMARLD L V FHAK+GTQGERV RI  L  ++A ++ AD 
Sbjct: 361 KLTASAEKLGLDMSKPLDQRMARLDQLGVTFHAKLGTQGERVQRIAKLAAELAPIVGADP 420

Query: 409 ALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENV 468
               RA +L+KADL TE+V EFPELQG +G+ YA LQNEN S   A EEH KP+GP + V
Sbjct: 421 EHATRAAMLAKADLTTEVVGEFPELQGVMGRIYAGLQNENASVALAAEEHYKPQGPSDQV 480

Query: 469 PTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDI----- 523
           PT+ +SI V+LADKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IRI++EN +D+     
Sbjct: 481 PTDPVSIAVALADKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRILVENGVDLRVVTS 540

Query: 524 --------------------------------PLSQFIEDQNLILFFHDRLKLYLHDRDI 551
                                            L +      L   + D+    +  R  
Sbjct: 541 SGETASLLRFIGTSVADHLVGLQMRGLAKIIADLEKLESKGALPSGYRDQFAKDMVSRKA 600

Query: 552 RHDLI----EAILRPENDNLLTIVDLIKH----------LNEFFSSAKGEKFLLSAKRI- 596
             + I    +      +D L    D +K           L +   + + +  L   +R+ 
Sbjct: 601 AENFINETADLSWAAASDLLSFFHDRLKVYLRDQGARHDLIDAVITPQSDDLLDITRRVA 660

Query: 597 ---------------------FQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
                                  ILA EEKK   ++  I P    L+AE+ L+  ++   
Sbjct: 661 ALGAFLDTDDGKNLLAGTKRGANILAAEEKKGTAVAETIDPALFELDAERNLFNAVTQSV 720

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           +   + ++++ Y      L ++ EP++ FF+ VLVN DD  VR NRL+LL  I++    V
Sbjct: 721 SAAIQVIENEDYAAAMSALATLREPVDSFFEAVLVNADDEAVRANRLALLAMIRHATGAV 780

Query: 696 INVQKI 701
            +  +I
Sbjct: 781 ADFSRI 786


>gi|307262297|ref|ZP_07543946.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868060|gb|EFM99887.1| Glycyl-tRNA synthetase beta subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 689

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 205/720 (28%), Positives = 341/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL +   GL   
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVENELNQAGLSFEKVEWFAAPRRLAVKALGLVTA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKKIEKRGPAVSAAFDADGKPTKAAEGWARGCGISVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  ++  +P PK MRW           ++RP+ ++      E     +
Sbjct: 123 EGQPTKNLLVDIISRSLANLPIPKMMRWGDKTE-----QFVRPVHTVTLFFGGE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +   N+  GHRF       +   D Y+  L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVKIANVVRGHRFLGEREFTISHADEYLTALREKGSVIADFNERKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEFPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGSLRIIVEKNLPLDLEDLVRKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVDDVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   EIS EI    L+   EK L   +      + 
Sbjct: 570 FRTLDSAEALAAANKRVSNILA---KVEGEISTEIDRTLLVEAEEKALAEQVISLQMELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +  +  Y    D L S+ E ++ FF++V+VN +D  +R NR ++L  ++N+ L V ++ 
Sbjct: 627 PTFANGEYQTALDRLASLRETVDNFFEKVMVNAEDANLRRNRQAILNNLRNLFLQVADIS 686


>gi|15804104|ref|NP_290143.1| glycyl-tRNA synthetase subunit beta [Escherichia coli O157:H7
           EDL933]
 gi|12518293|gb|AAG58707.1|AE005582_10 glycine tRNA synthetase, beta subunit [Escherichia coli O157:H7
           str. EDL933]
          Length = 689

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANXXAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|83642934|ref|YP_431369.1| glycyl-tRNA synthetase subunit beta [Hahella chejuensis KCTC 2396]
 gi|123767557|sp|Q2SQY0|SYGB_HAHCH RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|83630977|gb|ABC26944.1| Glycyl-tRNA synthetase, beta subunit [Hahella chejuensis KCTC 2396]
          Length = 692

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 211/721 (29%), Positives = 357/721 (49%), Gaps = 59/721 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           DFL+EI +EE+P +   + AE  +  +   L++  + +  +  Y  P RL +++ GL+  
Sbjct: 5   DFLVEIGAEELPPKALRQLAEAFAQGIRQRLEKAQLSFSELTWYAAPRRLAVHVSGLAEK 64

Query: 63  SPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P+   E+ GP         GA  KA +GF RS G       +++ D  KG   +   ++
Sbjct: 65  QPDLEVEKRGPALQAAFDAAGAPTKACEGFARSCGTTPDKLEKLETD--KGVWLVFRSKQ 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
                  +L  IV  ++  +P PK MRW    +      ++RP+  I+ +       EK+
Sbjct: 123 AGAPTTGLLPAIVEESLAALPIPKRMRWGARRT-----EFVRPVHWIIMLF-----GEKV 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEE-AMVLLDPECRRNAILNDAHR 234
           ID ++  +  GN T GHRFH P PI++ +  +Y   L+    V+ D E R+  I      
Sbjct: 173 IDCEILGLKAGNTTLGHRFHHPAPIEIATPANYKDALKNTGYVMADFEERKALIRQQVEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
           +A       V D++LLEE+  L EW    MG F+ ++L +P E +  T+K NQK F    
Sbjct: 233 IAKQTSGMAVIDEELLEEVASLNEWPTALMGRFEDRFLEVPAEALISTMKGNQKYFHVVD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            EG +   FI V+NI++ D    ++ GN RV+  RL DA  F+  D+             
Sbjct: 293 AEGRMLPYFITVANIESKD-PQQVIDGNERVIRPRLSDAAFFFSTDK------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L  R+  L    +VF  ++GT  ++  R+  L  KIA  ID++     RA
Sbjct: 339 -------KRTLASRLEDLKP--IVFQQQLGTVYDKAIRVGKLAAKIAAKIDSNPEWAQRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
             LSK DL TE+V EFPELQG +G+ YA + +E      A EE   PR   + +PT    
Sbjct: 390 GELSKTDLATEMVMEFPELQGTMGRYYAAIDSEPEEVSMAQEEQYLPRFAGDQLPTTLTG 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE---- 530
             VSLADKLDT++  + IN+ P+G+KDP+ LRRA LG++RI++E K+D+ L++ ++    
Sbjct: 450 CAVSLADKLDTIVGIFGINQPPTGAKDPFGLRRAALGVLRILVEKKLDLDLAECVQWAQE 509

Query: 531 ----------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEF 580
                     +  ++ +  DR + +  +  +  ++  ++L       +     +  + EF
Sbjct: 510 LHGDLPAENLETAVVDYMLDRFRAWYEEAGVPTEVFLSVLARRPTKPVEFDQRVLAVAEF 569

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
                 +    + KR+  IL+ E+      +   +P+    EAEK L+  + +     + 
Sbjct: 570 LKLDAAQALAAANKRVSNILSKEQ--VDISAESANPELFTEEAEKNLFRALQEKSESARP 627

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
            ++ + + Q    L  + + I++FFD+V+V VDD  +R NR++LL  ++++ L V ++  
Sbjct: 628 YIEQRNFTQALQQLAELKDVIDLFFDKVMVMVDDPAIRSNRMTLLASLRHVFLQVADISL 687

Query: 701 I 701
           +
Sbjct: 688 L 688


>gi|320187712|gb|EFW62387.1| Glycyl-tRNA synthetase beta chain [Shigella flexneri CDC 796-83]
          Length = 689

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +      E  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLVESFAANFTVELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|261221621|ref|ZP_05935902.1| glycyl-tRNA synthetase subunit beta [Brucella ceti B1/94]
 gi|260920205|gb|EEX86858.1| glycyl-tRNA synthetase subunit beta [Brucella ceti B1/94]
          Length = 761

 Score =  632 bits (1630), Expect = e-179,   Method: Composition-based stats.
 Identities = 336/759 (44%), Positives = 443/759 (58%), Gaps = 74/759 (9%)

Query: 17  MQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVG 76
           MQ KAA DL  ++I  L + G+ Y+    YWTP RL L ++GL+  S +  E+  GP V 
Sbjct: 1   MQRKAAGDLKKMIIDGLVDAGLTYEAATAYWTPRRLVLDIRGLTVRSKDVHEDIKGPSVS 60

Query: 77  AGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVP 136
           A ++AI GFLR  GL  +S   +  DPKKGD Y+A L KP R  ED++  +VP  I+  P
Sbjct: 61  APEQAIQGFLRKAGLSDVSQAHVHSDPKKGDFYVAHLTKPGRAAEDIVAELVPQTIRNFP 120

Query: 137 WPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHA 196
           WPKSMRW    +   A  W+RPL+SILC    E  + K+ID D+  I  GN+TYGHRF +
Sbjct: 121 WPKSMRWGVASARPGALRWVRPLQSILCTFGPETEETKVIDFDVDGIKSGNVTYGHRFLS 180

Query: 197 PH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIG 255
               IKV+  + Y+  LE+A V+LD E R+  I  DAH LA A GLELVED  LLEE+ G
Sbjct: 181 DGQAIKVRRFEDYVEKLEKAFVVLDAERRKEIISQDAHNLAFASGLELVEDDGLLEEVSG 240

Query: 256 LVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV---------------LA 300
           LVEW  V MG F++++L +P E+IRLTI+ NQKCFVTR +                  L+
Sbjct: 241 LVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRKQGDASRLASPAPQHEEIQALS 300

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSN+ A DGG  I  GN +VV ARL DAL+FW  DQ++LP+L  L  SA KF LD
Sbjct: 301 NKFILVSNVAARDGGTEIAYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLD 360

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           L KPLDQRMARLD L+V FHAK+GTQG+RV RIR L  +IA L+ AD  L  RA VL+KA
Sbjct: 361 LKKPLDQRMARLDALNVTFHAKLGTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKA 420

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL TE+V EFPELQG +G++YA+LQ E+ +   A+EEH KP+GP + VP N +S+ V+LA
Sbjct: 421 DLQTEVVGEFPELQGAMGRKYALLQGEDKAVAAALEEHYKPQGPSDVVPKNPVSVAVALA 480

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI----------- 529
           DKLDTL+ FWAI+EKP+GSKDPYALRRA LG+IR++L  +   PL               
Sbjct: 481 DKLDTLVGFWAIDEKPTGSKDPYALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALQEGQ 540

Query: 530 EDQNLILF-----------------FHDRLKLYLHD------------------------ 548
             + L  F                   + L  Y  +                        
Sbjct: 541 MQRKLREFEAKLAAENSGDVDGEQDVDNALANYEKEIRAEAEASCGPVLADLLSFFHDRF 600

Query: 549 ------RDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAI 602
                    R+D I+A+L PE DNLL +   ++ L  F +   G+  L  AKR   ILA 
Sbjct: 601 KVHLKEEGARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDGKNLLAGAKRAANILAA 660

Query: 603 EEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIE 662
           EEKK  +++  + P  L    EK L+  ++     + E++  + ++     L  +  P++
Sbjct: 661 EEKKGTKVADRVDPALLREAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVD 720

Query: 663 IFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           IFFD+VLVN +D  VR NRL+LL  I+     V +  KI
Sbjct: 721 IFFDKVLVNDEDGNVRANRLALLDQIRAATGKVADFSKI 759


>gi|187731977|ref|YP_001882247.1| glycyl-tRNA synthetase subunit beta [Shigella boydii CDC 3083-94]
 gi|238689523|sp|B2U566|SYGB_SHIB3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|187428969|gb|ACD08243.1| glycyl-tRNA synthetase, beta subunit [Shigella boydii CDC 3083-94]
          Length = 689

 Score =  632 bits (1629), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTVELDNAGLAHGTVQWFAAPRRLTLKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|82779378|ref|YP_405727.1| glycyl-tRNA synthetase subunit beta [Shigella dysenteriae Sd197]
 gi|123560982|sp|Q328L9|SYGB_SHIDS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|81243526|gb|ABB64236.1| glycine tRNA synthetase, beta subunit [Shigella dysenteriae Sd197]
          Length = 689

 Score =  632 bits (1629), Expect = e-179,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFAIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKDQ-QQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQLQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLEAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|33152920|ref|NP_874273.1| glycyl-tRNA synthetase subunit beta [Haemophilus ducreyi 35000HP]
 gi|71153558|sp|Q7VKG6|SYGB_HAEDU RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|33149145|gb|AAP96662.1| glycyl-tRNA synthetase beta subunit [Haemophilus ducreyi 35000HP]
          Length = 688

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 210/722 (29%), Positives = 351/722 (48%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +   K A   +  +   L++ G+ ++ +  + TP RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKKLATAFADNIQAELEQAGLAFEKIEWFATPRRLAVKVLSLAIA 64

Query: 63  SPEKIEERLGPRVG-------AGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP VG          KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKEIEKRGPAVGSAFDADGQPTKAAEGWARGCGISVEQADRVVTD--KGEWLVHRAVV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +D+L  +V  A+ K+P  K MRW+          +IRP+ ++  +L       ++
Sbjct: 123 EGKPTKDLLVDMVASALAKLPIAKPMRWAD-----KTVQFIRPVHTVTLLL-----GNEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  I   N+  GHRF      ++   D Y + L +   V+ D   R+  IL DA  
Sbjct: 173 IEGEILGITIANVVRGHRFLGESQFQIAHADEYPQILRDKGAVIADFAERKAIILRDAQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     + DLLEE+  LVE+  V +  F++++L +P E +  T+K +QK F    
Sbjct: 233 KAAALGGVADIEDDLLEEVTSLVEYPNVLVAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           +EG L   FI VSNI   D  +AI++GN +VV  RL DA  F+K D              
Sbjct: 293 KEGNLLPHFIFVSNINPQD-PSAIIEGNEKVVRPRLSDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L  ++ RL+   V+F  ++GT  ++  RI  L   IA+ I ADV    RA
Sbjct: 338 ------LKQRLVDQLPRLET--VLFQQQLGTLRDKTDRIEQLSGVIAEQIGADVQKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E   PR   + +PT+ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ-- 532
            +V+LADK+DTL   + I + P G KDP+ALRRA LG++RII+E K+ + L   +E    
Sbjct: 450 CSVALADKIDTLTGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLVHLVEKSTG 509

Query: 533 -------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNKAVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +        EI+    +   E+ L   +      ++
Sbjct: 570 FRTFESAEALAAANKRVTNILAKAD----IAIGEINLSACVEPTERALAEAVLALKDEVR 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  +   L ++  P++ FFD V+VN +D  +R NRL++L  ++++ L V ++ 
Sbjct: 626 PLIAKANYTAVLTQLANLRTPVDNFFDHVMVNAEDPSLRQNRLAILSTLQSLFLEVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|322830761|ref|YP_004210788.1| glycyl-tRNA synthetase, subunit beta [Rahnella sp. Y9602]
 gi|321165962|gb|ADW71661.1| glycyl-tRNA synthetase, beta subunit [Rahnella sp. Y9602]
          Length = 689

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 196/723 (27%), Positives = 331/723 (45%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
             FL+EI +EE+P +     AE  +  L   L    + + +++ +  P RL L + GL  
Sbjct: 4   KTFLVEIGTEELPPKALRSLAESFAANLTAELDAANLPHGDVKWFAAPRRLALKVSGLHE 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
              ++  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +    
Sbjct: 64  SQADREVEKRGPAVAQAFDAEGKPSKAAEGWARGCGITVDQADRLVTD--KGEWLVYRAH 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
                 + +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L      ++
Sbjct: 122 VKGESAQQLLPAMIATSLSKLPIPKLMRWGDSD-----VQFVRPVHTVTLLL-----GDE 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAH 233
           +I   +  I       GHRF       + + D Y +  LE   V+ D E R+  I  DA 
Sbjct: 172 LIPAKILGIDSARTLRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEQRKALIKRDAE 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
           + A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F   
Sbjct: 232 KAAKEIGGIADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
              G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+            
Sbjct: 292 DAAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------ 338

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    K L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I A+V    R
Sbjct: 339 --------KKRLEDNLPRLET--VLFQKQLGTLRDKTDRIQALSGWIAEKIGANVENAKR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P + +
Sbjct: 389 AGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEQEEVAVALNEQYQPRFAGDELPASLV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           +  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+  
Sbjct: 449 ACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAV 508

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                         +++ F   R + +  +     D I+A+L             +K ++
Sbjct: 509 RLYGDKLTNEKVVDDVVDFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKAVS 568

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F +  +      + KR+  ILA   K    +   +    L   AE +L   +      +
Sbjct: 569 YFRTLDEAATLAAANKRVSNILA---KSTDVLLDHVHASVLKEPAELKLATHLVVLRDKL 625

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           +      +Y +    L ++ E ++ FFD V+V  ++  VR NRL+LL  ++ + L V ++
Sbjct: 626 EPLFAAGQYKEALVELAALRETVDTFFDTVMVMDENEAVRINRLTLLSKLRELFLQVADI 685

Query: 699 QKI 701
             +
Sbjct: 686 SLL 688


>gi|82545927|ref|YP_409874.1| glycyl-tRNA synthetase subunit beta [Shigella boydii Sb227]
 gi|123558352|sp|Q31V62|SYGB_SHIBS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|81247338|gb|ABB68046.1| glycine tRNA synthetase, beta subunit [Shigella boydii Sb227]
 gi|332089349|gb|EGI94453.1| glycyl-tRNA synthetase beta subunit [Shigella boydii 3594-74]
          Length = 689

 Score =  631 bits (1628), Expect = e-178,   Method: Composition-based stats.
 Identities = 205/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +      E  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLVESFAANFTVELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYACHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  +S  ++   L    E +L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|170718076|ref|YP_001785112.1| glycyl-tRNA synthetase subunit beta [Haemophilus somnus 2336]
 gi|189082269|sp|B0UWA9|SYGB_HAES2 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|168826205|gb|ACA31576.1| glycyl-tRNA synthetase, beta subunit [Haemophilus somnus 2336]
          Length = 688

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 205/720 (28%), Positives = 347/720 (48%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEQELNQAGLAFEKVEWFAAPRRLAVKVLGLAEA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKQVEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERLATD--KGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  I+  A+  +P PK+MRW           ++RP+ ++  +  A+     +
Sbjct: 123 EGQPTKNLLVGIIDKALAGLPIPKTMRWGDKTE-----QFVRPVHTVTLLFGAD-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF       +   D Y + L+E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASGRTVRGHRFLGEREFSLDHADQYPQLLKERGSVVADFNERKALILATSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     +++LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEELLEEVTSLVEYPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPDD-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD     RA
Sbjct: 338 ------LKQKLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADQTKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEDVAVALNEQYMPRFAGDTLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK+DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +     
Sbjct: 450 CSVALADKIDTLTGIFGIGQSPKGSADPFALRRAALGCLRIIVEKNLPLDLVDIVAKATA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +     I  D+I+++L             ++ ++ 
Sbjct: 510 LFGDKLTNKNVVDEVVDFMLGRFRAWYESEGIAVDVIQSVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI L +     +  AEK L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADIAIGEIDLGV----CVESAEKTLAEAVIALKGEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++ +PI+ FFD V+VNV+++ +R NRL++L  ++N+ L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRQPIDAFFDGVMVNVEEQTLRQNRLAILSTLQNLFLQVADIS 685


>gi|113460624|ref|YP_718690.1| glycyl-tRNA synthetase subunit beta [Haemophilus somnus 129PT]
 gi|123131976|sp|Q0I273|SYGB_HAES1 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|112822667|gb|ABI24756.1| glycyl-tRNA synthetase beta chain [Haemophilus somnus 129PT]
          Length = 688

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 205/720 (28%), Positives = 348/720 (48%), Gaps = 62/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ ++ +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVEQELNQAGLAFEKVEWFAAPRRLAVKVLGLAEA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++     KG+  +     
Sbjct: 65  QPSKQVEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQAERL--STDKGEWLVHRAVI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +L +++L  I+  A+  +P PK+MRW           ++RP+ ++  +  A+     +
Sbjct: 123 EGQLTKNLLVGIIDKALAGLPIPKTMRWGDKTE-----QFVRPVHTVTLLFGAD-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF       +   D Y + L+E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASGRTVRGHRFLGEREFSLDHADQYPQLLKERGSVVADFNERKALILATSRE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     +++LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEELLEEVTSLVEYPNVLTAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPDD-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ R+ RL+   V+F  ++GT  ++ +RI  L  +IA  I AD     RA
Sbjct: 338 ------LKQKLEDRLPRLET--VLFQQQLGTLRDKTARIEALAGEIAAQIGADQTKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEDVAVALNEQYMPRFAGDTLPNSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V+LADK+DTL   + I + P GS DP+ALRRA LG +RII+E  + + L+  +     
Sbjct: 450 CSVALADKIDTLTGIFGIGQSPKGSADPFALRRAALGCLRIIVEKNLPLDLADIVAKATA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +     I  D+I+++L             ++ ++ 
Sbjct: 510 LFGDKLTNKNVVDEVVDFMLGRFRAWYESEGIAVDVIQSVLARRPTKPADFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA  +    EI L +     +  AEK L   +      +Q
Sbjct: 570 FRTLDSAEALAAANKRVSNILAKADIAIGEIDLGV----CVESAEKTLAEAVLALKGEVQ 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  + D L ++ +PI+ FFD V+VNV+++ +R NRL++L  ++N+ L V ++ 
Sbjct: 626 PLIAQGDYTAVLDKLANLRQPIDAFFDGVMVNVEEQTLRQNRLAILSTLQNLFLQVADIS 685


>gi|242237521|ref|YP_002985702.1| glycyl-tRNA synthetase subunit beta [Dickeya dadantii Ech703]
 gi|242129578|gb|ACS83880.1| glycyl-tRNA synthetase, beta subunit [Dickeya dadantii Ech703]
          Length = 689

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 207/724 (28%), Positives = 336/724 (46%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L   G+ YQ++  +  P RL L + G
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDTAGLGYQSVNWFAAPRRLALKVAG 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAIAQAFDAAGHPTKAAEGWARGCGITVSQAERL--TTDKGEWLLF 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             +      + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L     
Sbjct: 119 RAQVKGEAAQALLPGMVSAALAKLPIPKLMRWGDNDT-----QFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++   +  I       GHRF       + + D Y +  LE   VL D E R+  I  
Sbjct: 169 GDELVPGTVLGIDSARTLRGHRFMGEPEFTIDNADQYPQILLERGKVLADYEARKAQIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAARNIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIIAGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI  L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGTLRDKTDRIAALAGWVAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 AKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG +RII+E ++ + L    E
Sbjct: 446 SPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAAALAAANKRVSNILA---KSTETLNDGVQAALLKENEEIQLATYVTALT 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +       RY +    L  + E ++ FFD+V+VN +D++VR NRL+LL  ++N+ L V
Sbjct: 623 SKLAPWFAEGRYQEALVELAQLRESVDNFFDKVMVNAEDQQVRINRLTLLNELRNLFLKV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|304398082|ref|ZP_07379957.1| glycyl-tRNA synthetase, beta subunit [Pantoea sp. aB]
 gi|304354368|gb|EFM18740.1| glycyl-tRNA synthetase, beta subunit [Pantoea sp. aB]
          Length = 689

 Score =  631 bits (1627), Expect = e-178,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 336/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +  +   L    + +  +  +  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAEAFAAQVTAELDAANLSHGEVSWFAAPRRLALKVANLSAS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +   + 
Sbjct: 65  QPDREVEKRGPAVSAAFDADGNATKAAEGWARGNGITVDQAERLATD--KGEWLVYRAQV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
                + +L  ++  A+ K+P PK MRW  +        ++RP+ ++  +L      +++
Sbjct: 123 KGEAAQALLPAMIATALSKLPVPKLMRWGDSD-----VQFVRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF     I + + D Y   LE+   V+ D + R+  I  DA  
Sbjct: 173 IPGTILGIKSDRVIRGHRFMGESEITLDNADQYPDVLEKRGQVIADYQVRKAMIKADAEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F    
Sbjct: 233 AARRLGGNADISDSLLEEVTSLVEWPVVLTATFEEKFLKVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            +G L   FI V+NI++S+    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 NDGNLMPNFIFVTNIESSE-PRQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV    RA
Sbjct: 339 -------KKRLEDHLPRLET--VLFQKELGTLRDKTDRIQALASWIAGEIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P++ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSSPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        ++I F   R + +  +     D ++A+L             +K ++ 
Sbjct: 510 LYGSKLSNARVVDDVIDFMLGRFRTWYQEEGHSIDTLQAVLARRPTRPADFDARMKAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L    E +L   ++   + +Q
Sbjct: 570 FRTLEAASALAAANKRVSNILA---KSTETLNESVQASLLKENEEIQLATFVTALSSKLQ 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY      L  +   ++ FFD+V+VN DD+ VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PYFAEGRYQDALVELAQLRTAVDNFFDKVMVNADDQAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|317494687|ref|ZP_07953099.1| glycyl-tRNA synthetase beta subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917289|gb|EFV38636.1| glycyl-tRNA synthetase beta subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 689

 Score =  630 bits (1626), Expect = e-178,   Method: Composition-based stats.
 Identities = 207/720 (28%), Positives = 341/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL L +  L   
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDNADLAHGEVTWYAAPRRLALKVAALHES 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L    +
Sbjct: 65  QPDREIEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQAERLTSD--KGEWLLFRAHQ 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L T+V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQQLLPTLVTNALGKLPIPKLMRWGNNDT-----QFVRPVHTVTLLLGSE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I   +  IP   +  GHRF       + + D Y + L     V+ D E R+  I  D+ +
Sbjct: 173 IPATILGIPSDRVIRGHRFMGEPQFTIDNADQYPQILMERGKVIADYETRKAIIKRDSEQ 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGIADMSESLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGKLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++ +RI  L   IA+ I ADV L  RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQQQLGTLRDKTNRIEALSGWIAEQIGADVNLATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    EN     A+ E  +PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGENEEVAVALNEQYQPRFAGDALPESLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            +V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E K+ + L    E+   
Sbjct: 450 CSVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLVTLTEEAAR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             +K ++ 
Sbjct: 510 LYGQKLTNANVVDDVVDFMLGRFRAWYQEEGHSVDTIQAVLARRPTKPADFDARMKAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLPEAAALAAANKRVSNILA---KSTEVLADRVHASVLKEAAEIKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY +    L ++ EP++ FF+QV+V  +D +VR NRL+LL  ++++ L V ++ 
Sbjct: 627 PLFAEGRYQEALSELAALREPVDDFFEQVMVMAEDEQVRINRLTLLSKLRDLFLQVADIS 686


>gi|319406070|emb|CBI79700.1| glycyl-tRNA synthetase beta chain [Bartonella sp. AR 15-3]
          Length = 742

 Score =  630 bits (1625), Expect = e-178,   Method: Composition-based stats.
 Identities = 337/738 (45%), Positives = 453/738 (61%), Gaps = 37/738 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD LLE++SEEIPA MQ +AA DL   +I  L   G+ Y+   +YWTP RL L ++GLS
Sbjct: 1   MPDLLLELFSEEIPASMQRRAASDLKKCVINKLVNAGLTYKVACEYWTPRRLTLNIRGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP V + ++ ID FLR+TGL  IS   I  D KKGD Y+A   +  RL 
Sbjct: 61  KSSPNVHEERKGPNVQSPQQIIDAFLRTTGLNDISKLHIAHDDKKGDFYIAKTTQKGRLA 120

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           E+++  I+P  I+  PW KSMRW    +   A  WIR L++ILC+  +   +  +I   +
Sbjct: 121 EEIIADILPDIIRNFPWKKSMRWGKESAKSGALKWIRSLQNILCVFGSAMDETHVIPFTV 180

Query: 181 KEIPCGNITYGHRFHAPH-PIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
             +   N+TYGHRF +   PI+++  D Y+  LE   V+LD E R++ IL DA  L  A 
Sbjct: 181 GSLKSNNLTYGHRFLSNGEPIQIRRFDDYVTQLENHKVILDAERRKDIILADAQNLCFAN 240

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT--RTREG 297
           GLEL+EDK LLEE+ GLVEW  V MG+FDK +L +P E+IRLTI+T+QKCFVT  R  +G
Sbjct: 241 GLELIEDKALLEEVAGLVEWPVVLMGNFDKTFLNIPPEIIRLTIQTHQKCFVTHKRGEKG 300

Query: 298 VLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKF 357
            L+N FILV+NI ASD G  I +GNS+VV ARL DAL+FW+ DQ NLPN++ L+ SA K 
Sbjct: 301 KLSNHFILVANILASDKGIEISKGNSKVVHARLSDALYFWQTDQCNLPNITRLESSAKKL 360

Query: 358 NLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVL 417
           +LDL+KPLDQR+A LD L+V FH K+GTQG RV RI  L + IA L  AD  L  RA VL
Sbjct: 361 DLDLNKPLDQRIAHLDYLNVTFHTKLGTQGARVERIATLTQTIAPLAQADSILAKRAAVL 420

Query: 418 SKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITV 477
           +KADL T IV EFPELQG IG++YA+LQ E+    +AIE+H KP GP + +P   I+ITV
Sbjct: 421 AKADLQTGIVSEFPELQGLIGRKYALLQGEDPRVAEAIEDHYKPLGPKDRIPFEPIAITV 480

Query: 478 SLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQ----- 532
           +LADK+DTLI FW INEKP+ SKDPYALRRA LG+I++IL N   I L   +        
Sbjct: 481 ALADKIDTLIGFWFINEKPTSSKDPYALRRAALGVIKLILLNDWKINLIPLLHQAMNCLL 540

Query: 533 -----------------------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPE 563
                                        +L+ FFH+RLK YL D   RHD+IEA+L   
Sbjct: 541 QQKIKYATSEIESVQLQNMSIEKKENIILDLLAFFHERLKGYLKDEGARHDIIEAVLTKS 600

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEA 623
           +D++L I   ++ L  F ++  G+  L++ KR   IL  E KK   I  ++ P+  +   
Sbjct: 601 DDDILFITRRVEALTFFINTHDGDSLLIAVKRAINILENEIKKGTAIINKVKPELFIETE 660

Query: 624 EKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLS 683
           EK+LY    +    I + +       + + L  + +PI  FF++V VN D+  +R NR +
Sbjct: 661 EKQLYQATIETEKKIADHIHVTELSSVLNSLSLLKKPINAFFEKVFVNDDNINIRANRFA 720

Query: 684 LLQYIKNIILIVINVQKI 701
           LL+ I+ +   V +  K+
Sbjct: 721 LLERIRIVTQRVADFSKL 738


>gi|292490371|ref|YP_003525810.1| glycyl-tRNA synthetase subunit beta [Nitrosococcus halophilus Nc4]
 gi|291578966|gb|ADE13423.1| glycyl-tRNA synthetase, beta subunit [Nitrosococcus halophilus Nc4]
          Length = 691

 Score =  630 bits (1625), Expect = e-178,   Method: Composition-based stats.
 Identities = 220/722 (30%), Positives = 354/722 (49%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           D L+EI +EE+P +   K +E L+  L   L+  G+ Y +++ Y  P RL ++++ L+  
Sbjct: 6   DLLIEIGTEELPPKALRKLSESLTQELSQRLQAAGLAYGSLKGYGAPRRLAVWVQELTAS 65

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P+++ ER GP +       G    A  GF RS G+       ++ +  KG   +   R+
Sbjct: 66  QPDRVLERRGPALTAAFDDEGRATAAAQGFARSCGVPVDELESLESE--KGAWLVHRQRR 123

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
                 ++L  I+  ++Q +P PK MRW+       +  +IRP+  ++ +       ++ 
Sbjct: 124 QGAPTRELLPDILAQSLQALPIPKRMRWNDL-----SVEFIRPVHWLVLLF-----GDEA 173

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I  +L  +     T GHRFH P P+ +     Y   LE E  VL D   RR AI      
Sbjct: 174 IPAELLGVQADRETRGHRFHHPAPLYLAEPAAYGPLLETEGKVLADFSVRREAIYAQVVE 233

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  VG E + +  LL+E+ GLVEW     G F+  +L LPEE++  T++ +QK F  R 
Sbjct: 234 AAKKVGGEALVEDALLDEVTGLVEWPVALAGRFEPDFLQLPEEVLIATMQDHQKYFPVRD 293

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            +G L   FI VSNI++ +   A+V+GN RV+  RL DA  F+  D+             
Sbjct: 294 GQGHLLPYFITVSNIES-EQPEAVVEGNERVIRPRLADAAFFYATDR------------- 339

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L  R  +L    + F  K+G+  ER  R+  L + IA  I  +    +RA
Sbjct: 340 -------KESLASRCGKLK--KITFQEKLGSVFERTERLAQLARSIAISIGGNGDWAERA 390

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL TE+V EFPELQG +G+ YA+  +E     +A+ E   PR   + +P     
Sbjct: 391 GLLSKCDLVTEMVTEFPELQGIMGRYYALRDDEPAEVAEALREQYLPRFAGDKLPGTPTG 450

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP---------- 524
             +SLAD+LDTL+  + I E PSG +DPY LRRA LG++RII+E ++ +           
Sbjct: 451 QALSLADRLDTLVGLFGIGEPPSGDRDPYGLRRAALGVLRIIIEAELGLDLRLLLERGCQ 510

Query: 525 -----LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                L++      +  +  +RL+ Y  +   R D IEA+L  +          +K +  
Sbjct: 511 AYGGRLTESNTAAQVHDYLLERLRGYYLEAGFRPDEIEAVLVLKPGRPWDFDRRLKGVAS 570

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F    + E    + KRI  IL   ++K   I  ++ P  L   AE+ L   + D    + 
Sbjct: 571 FRELPEAESLSAANKRIRNILRKSKEK---IPPQVEPGLLQDPAEQALATQMYDLEREVS 627

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             ++ + Y      L S+   ++ FFD+V+V V+D  +R NRL+LL+ ++ + L V ++ 
Sbjct: 628 PLLERQDYQAALRALASLRGAVDRFFDEVMVMVEDPALRANRLALLERLQTLFLQVADIS 687

Query: 700 KI 701
           ++
Sbjct: 688 RL 689


>gi|50119046|ref|YP_048213.1| glycyl-tRNA synthetase subunit beta [Pectobacterium atrosepticum
           SCRI1043]
 gi|81827262|sp|Q6DB17|SYGB_ERWCT RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|49609572|emb|CAG73005.1| glycine-tRNA synthetase, beta subunit [Pectobacterium atrosepticum
           SCRI1043]
          Length = 689

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 204/724 (28%), Positives = 332/724 (45%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L    + + ++  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLAHGDVSWFAAPRRLALKVAR 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVEQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRWS   +      ++RP+ ++  +L     
Sbjct: 119 RAHAKGEQAQALLAGMVSTALSKLPIPKLMRWSDKET-----QFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            E++I   +  I       GHRF       + + + Y +  LE   V+ D + R+  I  
Sbjct: 169 GEELIPGQVLGIHSARTIRGHRFMGEAEFTIDNAEQYPQILLERGKVVADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEDAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGNLLPHFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGSLRDKTDRIQALAGWVASQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+D+L   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDSLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 +I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGTKLTNTKAVDEVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F S         + KR+  ILA   K   +++  ++   L   AE  L   +    
Sbjct: 566 AVSHFRSLDAAAALAAANKRVSNILA---KSTDKLNESVNAAVLKDAAEITLATHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +       RY +    L S+ EP++ FFDQV+V  +D +VR NRL+LL  ++ + L V
Sbjct: 623 DKLTPLFAEGRYQEALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|167630520|ref|YP_001681019.1| glycyl-tRNA synthetase, beta subunit [Heliobacterium modesticaldum
           Ice1]
 gi|167593260|gb|ABZ85008.1| glycyl-tRNA synthetase, beta subunit [Heliobacterium modesticaldum
           Ice1]
          Length = 691

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 217/729 (29%), Positives = 344/729 (47%), Gaps = 72/729 (9%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           D LLEI +EEIPA+    A   L  +    L+E  + Y  +  Y TP RL LY+K ++  
Sbjct: 5   DLLLEIGTEEIPAKFIPSALAQLRQLAEKGLQEARLAYGAVETYGTPRRLTLYVKQVAAQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +   E  GP V       G   KA  GF RS G+   +   + +D        A+  +
Sbjct: 65  QEDLRLEVKGPAVKAGFDKEGNPTKAAQGFARSQGVDVSA--LVTRDLAGVPYLYALRTE 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             R   DVL  ++   I  + +PK MRW+          + RP++ I+ +       E++
Sbjct: 123 SGRPARDVLPQLLQGCISGLSFPKPMRWA-----WGETRFARPIRWIVALY-----GEEV 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRL 235
           I ++++ +  G  TYGHRF    PI++     Y+  LE+A V+ DP  R+  I      L
Sbjct: 173 IPVEVEGVQAGRTTYGHRFLGGGPIELTRPSEYLERLEKAYVIADPHKRKAMIWKQITEL 232

Query: 236 ASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR 295
           A+AVG ++ ED+ LL+EI  LVE+     G  D  Y+ LPE ++   +K +Q+ F  ++ 
Sbjct: 233 AAAVGGQVAEDEGLLDEINYLVEYPTALCGEVDADYMHLPEAVLITPMKEHQRYFPVKSP 292

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
            G L   FI V N   ++  + +  GN +V+ ARL DA  F+  DQ              
Sbjct: 293 SGGLLPTFITVRNG-TAEHLSIVRAGNEKVLRARLADAAFFYAEDQ-------------- 337

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD--- 412
                   PLD +  +L    +VF   +GT  ERV R + L   +A  ++    L +   
Sbjct: 338 ------KTPLDAQKEKLK--KIVFQESLGTVYERVEREQALTAFLADCMNVPAVLREGAL 389

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA  L+KADL T +V EFPELQG +G+ YA+L  E      AI EH +PR   + VP+  
Sbjct: 390 RAAELAKADLVTHMVYEFPELQGIMGERYALLSGEAPEVAQAIREHYQPRFSGDAVPSTM 449

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE-- 530
               V+LADK+D ++  ++I   P+GS+DPYALRR   G+ +II+   + + L+  IE  
Sbjct: 450 EGTLVALADKIDAIVGCFSIGIIPTGSQDPYALRRQAQGVCQIIMRGNLPLSLAAVIEKS 509

Query: 531 -----------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDL 573
                             ++L+ FF  RL+  L +  IR+D I+A+L    D    ++  
Sbjct: 510 YNLYAAAGRPTRSLEETQKDLLEFFRQRLRFLLGEEGIRYDTIDAVLAEGFDQPAEVLKR 569

Query: 574 IKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISD 633
            K L++F  +      + +  R   +           S  I P       E  LY  +  
Sbjct: 570 AKALSDFRQAEAFSALITAYTRAANLAKKGG------SEPIRPDLFEQATEGELYKALQA 623

Query: 634 FGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIIL 693
               ++++     Y  I   + ++   ++ FFD V+V  D+  +R+NRL+LL  +  +  
Sbjct: 624 AEEQVRQA--DGDYSTILAAVAALRPAVDAFFDAVMVMADEPVIRENRLALLNGVIGLTR 681

Query: 694 IVINVQKIV 702
            V ++ K+V
Sbjct: 682 GVADLSKLV 690


>gi|261344460|ref|ZP_05972104.1| glycyl-tRNA synthetase, beta subunit [Providencia rustigianii DSM
           4541]
 gi|282567368|gb|EFB72903.1| glycyl-tRNA synthetase, beta subunit [Providencia rustigianii DSM
           4541]
          Length = 689

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 194/720 (26%), Positives = 337/720 (46%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDGADISHGAVTWFAAPRRLALKVANLAAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L   + 
Sbjct: 65  QPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAQM 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             + + ++L  +V  ++ K+P PK MRW+   +      ++RP+ ++  +L ++     +
Sbjct: 123 KGQAVSELLIDMVSRSLSKLPIPKLMRWADKET-----QFVRPVHTVTLLLGSD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           ++ ++  I  G    GHRF       + + D Y   L     V+ D E R+  I  D+ +
Sbjct: 173 VEGEILGIKSGRTIRGHRFMGEAEFTIDNADQYPEILRERGKVIADYETRKATIKADSEK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A A+G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQALGGKADLTESLLEEVTSLVEWPVVLTAKFEEKFLDVPSEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++SD    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 NAGKLMPNFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  R+  L   IA  I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQQQLGTLRDKTDRLEALSGWIASKIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +L+K DL T +V EF + QG +G  YA    E+     A++E  +PR   + +P+  +S
Sbjct: 390 GLLAKCDLMTNMVFEFTDTQGVMGMHYARHDGESEDVALALKEQYQPRFAGDELPSTDVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             ++LA+K+DTL   + I + P G KDP+ALRRA LG++RII+E    + L +  ++   
Sbjct: 450 AALALAEKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKGYQLDLVEMTQEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGDKLTNKNVVDDVVEFMLGRFRSWYQELGYSIDAIQAVLARRPTQPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S  + +    + KR+  IL+   K + +++  +    L    E +L   +      + 
Sbjct: 570 FRSLDEAQALAAANKRVSNILS---KSDEKLADSVLASVLKTPEEVKLATHLVVLQDKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                + Y +    L S+ E ++ FF  V+V  +D  VR+NRL+LL  ++ + L V ++ 
Sbjct: 627 PMFAERNYQEALVELASLREVVDEFFANVMVMDEDPAVRNNRLTLLSQLRELFLKVADIS 686


>gi|308188778|ref|YP_003932909.1| glycyl-tRNA synthetase, beta subunit [Pantoea vagans C9-1]
 gi|308059288|gb|ADO11460.1| Glycyl-tRNA synthetase, beta subunit [Pantoea vagans C9-1]
          Length = 689

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 336/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +  +   +    + +  +  +  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAEAFAAQVTAEMDAANLSHGEVSWFAAPRRLALKVANLSAS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +   + 
Sbjct: 65  QPDREVEKRGPAVAAAFDADGNATKAAEGWARGNGITVDQAERLATD--KGEWLVYRAQV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
                + +L  ++  A+ K+P PK MRW  +        ++RP+ ++  +L      +++
Sbjct: 123 KGEAAQALLPAMIATALSKLPVPKLMRWGDSD-----VQFVRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF     I + + D Y   LE+   V+ D + R+  I  DA  
Sbjct: 173 IPGTILGIKSDRVIRGHRFMGESEITLDNADQYPDVLEKRGQVIADYQVRKAMIKADAEA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F    
Sbjct: 233 AARRLGGNADISDSLLEEVTSLVEWPVVLTATFEEKFLKVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            +G L   FI V+NI++SD    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 NDGNLMPNFIFVTNIESSD-PRQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQKELGTLRDKTDRIQTLAGWIAGEIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P++ ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSSPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        ++I F   R + +  +     D ++A+L             +K ++ 
Sbjct: 510 LYGSKLSNARVVDDVIDFMLGRFRTWYQEEGHSIDTLQAVLARRPTRPADFDARMKAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L    E +L   ++   + +Q
Sbjct: 570 FRTLEAAAALAAANKRVSNILA---KSTETLNESVQASLLKENEEIQLATFVTALSSKLQ 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY      L  +   ++ FFD+V+VN DD+ VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PYFAEGRYQDALVELAQLRTAVDNFFDKVMVNADDQAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|261867209|ref|YP_003255131.1| glycyl-tRNA synthetase subunit beta [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412541|gb|ACX81912.1| glycyl-tRNA synthetase beta subunit [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 693

 Score =  630 bits (1624), Expect = e-178,   Method: Composition-based stats.
 Identities = 210/727 (28%), Positives = 347/727 (47%), Gaps = 67/727 (9%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+EI +EE+P +     A   +  +   L + G+ +  +  +  P RL + +  L+  
Sbjct: 5   NFLVEIGTEELPPKALKTLATAFADNVQAELNQAGLAFDKIEWFAAPRRLAVKVLALATQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +   + 
Sbjct: 65  QPGKEIEKRGPAVSAAFDAEGNPTKAAEGWARGCGITVDQAERLATD--KGEWLVHRAKI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLADIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF      ++Q  D Y + L E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVASGRTIRGHRFLGEREFEIQHADQYPQLLREKGSVVADFNERKAEILAKSQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR- 293
            A+A+G     ++ LLEE+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPLYK 292

Query: 294 ----TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSS 349
                ++G L   FI VSNI   D  +AI++GN +VV  RL DA  F+K D         
Sbjct: 293 KTEGDKDGKLLPHFIFVSNINPDD-PSAIIEGNEKVVRPRLTDAEFFFKTD--------- 342

Query: 350 LKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVA 409
                      L + L  R+ RL+   V+F  ++GT  ++  RI  L   IA+ I AD A
Sbjct: 343 -----------LKQKLVDRLPRLET--VLFQQQLGTLRDKTDRIEQLAGAIAKQIGADEA 389

Query: 410 LVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
              RA +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P
Sbjct: 390 KAKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELP 449

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
            + ++  V+LADK DTL   + I + P GS DP+ALRRA LG +RII+E  + + L   +
Sbjct: 450 KSLVASAVALADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLV 509

Query: 530 EDQ---------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
           +                 +++ F   R + +  D  I  D+I+A+L             +
Sbjct: 510 QKSAALFGDKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARV 569

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
           + ++ F +    E    + KR+  ILA  +    EI+L       +  AEK L   +   
Sbjct: 570 RAVSHFRTLDSAEALAAANKRVANILAKADVAIGEINLIA----CVESAEKNLAEAVLVL 625

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
            T +Q  +    Y  + D L ++  P++ FFD V+VN +D  +R NRL++L  ++ + L 
Sbjct: 626 QTEVQPLIAKGEYTAVLDKLANLRTPVDNFFDNVMVNAEDPTLRQNRLAILNTLQGLFLQ 685

Query: 695 VINVQKI 701
           V ++  +
Sbjct: 686 VADISLL 692


>gi|261823642|ref|YP_003261748.1| glycyl-tRNA synthetase subunit beta [Pectobacterium wasabiae
           WPP163]
 gi|261607655|gb|ACX90141.1| glycyl-tRNA synthetase, beta subunit [Pectobacterium wasabiae
           WPP163]
          Length = 689

 Score =  629 bits (1623), Expect = e-178,   Method: Composition-based stats.
 Identities = 206/724 (28%), Positives = 333/724 (45%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L    +++ ++  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLVHGDVSWFAAPRRLALKVAR 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LNASQPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVEQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRWS   +      ++RP+ ++  +L     
Sbjct: 119 RALAKGEQAQALLAGMVSTALSKLPIPKLMRWSDKET-----QFVRPVHTVTMLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            E++I   +  I       GHRF       + S D Y +  LE   V+ D + R+  I  
Sbjct: 169 GEELIPGQVLGIHSARTIRGHRFMGEAEFTIDSADQYPQILLERGKVVADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGSLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 AMRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+D+L   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDSLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGTKLTNTKAVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F S         + KR+  ILA   K    ++  ++   L   AE  L   +    
Sbjct: 566 AVSHFRSLDAAAALAAANKRVSNILA---KSTDTLNESVNAAVLKDAAEITLATHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +       RY +    L S+ EP++ FFDQV+V  +D +VR NRL+LL  ++ + L V
Sbjct: 623 DKLTPLFAEGRYQEALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|212711578|ref|ZP_03319706.1| hypothetical protein PROVALCAL_02653 [Providencia alcalifaciens DSM
           30120]
 gi|212685680|gb|EEB45208.1| hypothetical protein PROVALCAL_02653 [Providencia alcalifaciens DSM
           30120]
          Length = 689

 Score =  629 bits (1623), Expect = e-178,   Method: Composition-based stats.
 Identities = 193/722 (26%), Positives = 337/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L ++ L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDSADITHGAVNWFAAPRRLALKVESLAAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L   + 
Sbjct: 65  QPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAQM 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             + + ++L  +V  ++ K+P PK MRW+   +      ++RP+ ++  +L ++     I
Sbjct: 123 KGQPVSELLIDMVSRSLAKLPIPKLMRWADKDT-----QFVRPVHTVTLLLGSD-----I 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           ++ ++  I    I  GHRF       + + + Y   L     V+ D   R+  I+ +A +
Sbjct: 173 VNGEILGIKSDRIIRGHRFMGEAEFTIDNAEQYPEILRTRGKVIADYAERKAIIIANAEK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A A+G +      L+EE+  LVEW  V    F+ K+L +P E +  T+K +QK F    
Sbjct: 233 AAKALGGKADLTDSLVEEVTSLVEWPVVLTAKFEDKFLEVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++SD    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 DAGKLMPNFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  R+  L   IA  I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQQQLGTLRDKTDRLEALAGWIASKIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +L+K DL T +V EF + QG +G  YA    E+     A++E  +PR   + +P+  +S
Sbjct: 390 GLLAKCDLMTNMVFEFTDTQGVMGMHYARHDGESEDVALALKEQYQPRFAGDELPSTDVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             ++LA+K+DTL   + I + P G KDP+ALRRA LG++RII+E    + L +  ++   
Sbjct: 450 AALALAEKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKGYQLDLVEMTQEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGDKLTNKNVVEDVVEFMLGRFRSWYQELGYSIDTIQAVLARRPTQPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S  + +    + KR+  IL+  E+K   ++  +    L    E +L   +      + 
Sbjct: 570 FRSLEEAQTLAAANKRVSNILSKSEEK---LADSVLASVLKTPEEVKLATHVVVLQDKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                + Y +    L S+ E ++ FF  V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PMFAERNYQEALVELASLREVVDEFFANVMVMDEDPAVRINRLTLLSQLRELFLKVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|290473327|ref|YP_003466193.1| glycine tRNA synthetase subunit beta [Xenorhabdus bovienii SS-2004]
 gi|289172626|emb|CBJ79395.1| glycine tRNA synthetase, beta subunit [Xenorhabdus bovienii
           SS-2004]
          Length = 689

 Score =  629 bits (1622), Expect = e-178,   Method: Composition-based stats.
 Identities = 204/722 (28%), Positives = 338/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      LK   + +  +  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFEAELKNANLGHGEISWFAAPRRLALKVANLAVA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L   + 
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQAERMVTD--KGEWLLYRAQV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             R  +++L  +V  ++ K+P PK MRW    +      ++RP+ ++  +L ++     +
Sbjct: 123 KGREAKELLADMVSSSLGKLPIPKLMRWGDKET-----QFVRPVHTVTMLLGSD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           ID ++  I    I  GHRF       + + + Y   L+E   V+ D   R+  I  DA +
Sbjct: 173 IDGEILGIKSDRIIRGHRFMGEAEFAIDNAEQYPTILQERGRVIADYYARKALIKRDAEQ 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAMQLGGVADLTDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           + G L   FI V+NI++SD    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 KSGKLMANFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I ADV    RA
Sbjct: 339 -------KQRLEDNLLRLET--VLFQKQLGTLRDKTDRIQALAGWIAEKIGADVTHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+  +S
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVALALNEQYQPRFSGDELPSTAVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E K+ + L    E+   
Sbjct: 450 CAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLQTLAEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  ++    D I+A+L             +K +  
Sbjct: 510 LYGDKLTNENVVDDVVEFMLGRFRTWYQEQGYSVDAIQAVLARRPTQPADFDARMKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA  E+K   ++  +    L    E +L   +      + 
Sbjct: 570 FRTLDEAVSLAAANKRVSNILAKSEEK---LNDCVLASVLKAAEEIQLATHLVVLKDKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y      L S+ E ++ FFD V+V  +D++VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PLFAEGNYQDALVELASLREVVDAFFDNVMVMDEDQQVRINRLTLLSELRELFLRVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|238754024|ref|ZP_04615383.1| Glycyl-tRNA synthetase beta subunit [Yersinia ruckeri ATCC 29473]
 gi|238707776|gb|EEQ00135.1| Glycyl-tRNA synthetase beta subunit [Yersinia ruckeri ATCC 29473]
          Length = 689

 Score =  629 bits (1622), Expect = e-178,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 335/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +  +   L    + + ++  +  P RL + +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANITAELDSANLSHGDVSWFAAPRRLAVKVANLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVDQAERLATD--KGEWLLYRAHI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 IGQSAQLLLAGMVSTALSKLPIPKLMRWGDKET-----QFVRPVHTVTMLLGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + S + Y +  LE   V+ D E R++ I  DA  
Sbjct: 173 IPGTVLGIHSNRVIRGHRFMGEAEFTIDSAEQYPQILLERGKVIADYELRKSIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGNLMPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L   +A+ I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAEQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +N+P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDNLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA+LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRASLGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +  +     D I+A+L             +K ++ 
Sbjct: 510 LYGSKLTNGKVVDEVVEFMLGRFRAWYQEEGHSVDTIQAVLARRPTKPADFDARVKAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  ++   L   AE +L   +      + 
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDTLNDRVNAAVLKDSAELQLATHLVVLRDQLT 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY +    L ++ E ++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PLFAEGRYQEALVELATLRENVDAFFDNVMVMAEDDAVRINRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|329297820|ref|ZP_08255156.1| glycyl-tRNA synthetase subunit beta [Plautia stali symbiont]
          Length = 689

 Score =  629 bits (1622), Expect = e-178,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 335/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L   G+ + ++  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAEAFAAHFTAELDSAGLAHGDVSWFAAPRRLALKVAQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP V       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LAAAQPDREVEKRGPAVAAAFDAEGKPTKAAEGWARGNGITVEQAERL--STDKGEWLVH 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RTAVKGESAQALLPAMVATALSKLPIPKLMRWGASD-----VQFVRPVHTVTLLLS---- 169

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +++I   +  I    +  GHRF     + + + D Y + L+    V+ D   R+  I  
Sbjct: 170 -DELIPATILGIQSDRVIRGHRFIGEPELTLDNADQYPQLLQERGKVIADYVTRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G +      LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAQQLGGKADLSDRLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYAEDGQLLPNFIFVTNIESRD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDNLPRLET--VLFQKELGTLRDKTDRIQALAGWIAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 SPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGSKLSNANVVDDVIDFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K    ++  +    L   AE +L   ++  G
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KATETLNDSVQASLLKENAEIQLATFVTALG 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY      L  + E ++ FFD V+VN DD  VR NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFAEGRYQDALVELAQLREAVDNFFDNVMVNADDEAVRINRLTLLAQLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|227115350|ref|ZP_03829006.1| glycyl-tRNA synthetase subunit beta [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 689

 Score =  629 bits (1622), Expect = e-178,   Method: Composition-based stats.
 Identities = 204/724 (28%), Positives = 332/724 (45%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L    + + ++  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLAHGDVSWFAAPRRLALKVAR 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVEQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRWS   +      ++RP+ ++  +L     
Sbjct: 119 RAHAKGEQAQTLLAGMVSTALSKLPIPKLMRWSDKET-----QFVRPVHTVTMLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            E++I   +  I       GHRF       + + + Y +  LE   V+ D + R+  I  
Sbjct: 169 GEELIPGQVLGIDSARTLRGHRFMGEAEFTIDNAEQYPQILLERGKVVADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGSLRDKTDRIQALAGWVAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+D+L   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDSLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLSNAKVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F S         + KR+  ILA   K    ++  ++   L   AE  L   +    
Sbjct: 566 AVSHFRSLDAAAALAAANKRVSNILA---KSTDTLNESVNAAVLKDAAEITLATHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +       RY +    L S+ EP++ FFDQV+V  +D +VR NRL+LL  ++ + L V
Sbjct: 623 DKLTPLFAEGRYQEALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|16762654|ref|NP_458271.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144141|ref|NP_807483.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213163579|ref|ZP_03349289.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213428105|ref|ZP_03360855.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580726|ref|ZP_03362552.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213609113|ref|ZP_03368939.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213649464|ref|ZP_03379517.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213854638|ref|ZP_03382878.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|25009331|sp|Q8Z2B3|SYGB_SALTI RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|25293205|pir||AI0980 glycine-tRNA ligase (EC 6.1.1.14) - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504960|emb|CAD07973.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139778|gb|AAO71343.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 689

 Score =  629 bits (1622), Expect = e-178,   Method: Composition-based stats.
 Identities = 203/726 (27%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAYVKGESTEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y   L     V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNASVVDDVIDFMLGRFRAWYQDEGYSVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|283787796|ref|YP_003367661.1| glycine-tRNA synthetase, beta subunit [Citrobacter rodentium
           ICC168]
 gi|282951250|emb|CBG90944.1| glycine-tRNA synthetase, beta subunit [Citrobacter rodentium
           ICC168]
          Length = 689

 Score =  628 bits (1621), Expect = e-178,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGNVEWFAAPRRLALKVAK 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G++R  G+      ++     KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWVRGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAEALLPNMVAASLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDNVIPATILGIQSDRVIRGHRFMGEPQFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAIEAARKIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    IV GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIVSGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA    ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQTGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYSVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KSDETLNERVNAATLKEPEEIALAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + EP++ FF++V+VNV+D+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPFFAEGRYQEALVELAELREPVDAFFEKVMVNVEDKELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|149912060|ref|ZP_01900651.1| glycyl-tRNA synthetase beta subunit [Moritella sp. PE36]
 gi|149804856|gb|EDM64893.1| glycyl-tRNA synthetase beta subunit [Moritella sp. PE36]
          Length = 690

 Score =  628 bits (1620), Expect = e-178,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   + L+EI +EE+P +     AE  +      LK+ G+ + ++     P RL L +  
Sbjct: 1   MATENLLIEIGTEELPPKSLRTLAEAFAANFQAELKKAGLEFADVSWMAAPRRLALTVTA 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    +K+ E+ GP +       G   KA  G+ R  G+      +IK D  KG+  L 
Sbjct: 61  LADSQADKVIEKRGPAISVAFDADGNATKAAQGWARGNGITVEQAGRIKTD--KGEWLLH 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +  + ++  +V  A+ K+P  K MRW +     S   +IRP+ ++  +      
Sbjct: 119 KSEVKGQATQVLVADMVATALAKLPVSKPMRWGS-----SPIQFIRPVHTVTMLF----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILN 230
            ++ +  ++  I       GHRF      ++   D+Y+  LE+   V++D   R+  I  
Sbjct: 169 GDEALAGEILGIKAARTIRGHRFLGKGDFELPHADNYVDLLEDHGMVMVDYARRKEVIRQ 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
                A   G     D+ LLEE+  LVEW    +G+F+++YL +P E +  T+K NQK F
Sbjct: 229 QVIAAAEEHGGVAEIDEALLEEVTSLVEWPVTLVGNFEERYLDVPAEALIYTMKDNQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
              +++G L   FI VSNI + D     ++GN +VV  RL DA  F+  D+         
Sbjct: 289 PMLSKDGELLPKFIFVSNIISKDVRQV-IEGNEKVVRPRLADAEFFFNTDK--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       + L+ R+A L+   V+F  ++GT  E+  RI  L   IA  I A+   
Sbjct: 339 -----------KRTLESRLADLET--VIFQKQLGTLKEKSQRISDLAAAIAGKISANTEH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +L+KADL +++V EFP++QG +G  YA    E      A+ E   PR   + +P 
Sbjct: 386 AQRAGLLAKADLMSDMVVEFPDVQGVMGMHYARNDGEAEEVAIALNEQYMPRYAGDRLPE 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++ +V+LADKLDTL+  + I + P G KDP+ALRRA +G +RII+E  + + L   ++
Sbjct: 446 SLVACSVALADKLDTLVGIFGIGQIPKGDKDPFALRRAAIGTLRIIIEKDLPLDLVDLVD 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
                            +++ F   R   +  D  I  D+I+A+L             +K
Sbjct: 506 TAKLLFGDKLSNQNVSTDVVAFILGRFPAWYKDAGISVDVIQAVLARRPTKPADFDKRVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +N F           + KR+  ILA   K   E++  +    L  +AEK L A +    
Sbjct: 566 AVNHFRGLDAAATLAAANKRVGNILA---KFEGELNTTVDTSLLQEDAEKALAAAVDAKV 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +        Y Q    L  + + ++ FFD V+V  DD  ++ NRL+LL  ++N  L V
Sbjct: 623 ELLTPLFAAGDYQQALTELSELRDVVDTFFDNVMVMADDEALKINRLTLLNTLRNQFLNV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|315125117|ref|YP_004067120.1| glycyl-tRNA synthetase subunit beta [Pseudoalteromonas sp. SM9913]
 gi|315013630|gb|ADT66968.1| glycyl-tRNA synthetase subunit beta [Pseudoalteromonas sp. SM9913]
          Length = 689

 Score =  628 bits (1620), Expect = e-178,   Method: Composition-based stats.
 Identities = 215/723 (29%), Positives = 345/723 (47%), Gaps = 62/723 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   + L+EI +EE+P +   K AE  +  L   L+   + +Q +  Y +P RL L +K 
Sbjct: 1   MSAENLLVEIGTEELPPKSLRKLAEAFAANLTAELESLELAHQGVSWYASPRRLGLQVKA 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L     +K  E+ GP +       G   KA  G+ R  G++      ++ D  KG   L 
Sbjct: 61  LDAKQQDKEVEKRGPAIKAAFDAEGNPTKAAMGWARGCGIEVKDAQTLETD--KGAWLLH 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
           + +   +  + ++   +  A+ K+P PK MRW    +      +IRP+ ++  +L +E  
Sbjct: 119 IAKVAGQETKLLMADAISKALAKLPIPKPMRWGANKT-----QFIRPVHTVTILLGSE-- 171

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
              +I+ ++      N   GHRFH P  I +   D     L+ A V+ D E R+  I   
Sbjct: 172 ---LIEGEILGKQVSNQLQGHRFHHPEKISINHADDVFDVLKSAYVIADYEQRKAQIRAQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
               A AV   +  D+DLLEE+  LVEW      +F++ +L +P E +  T+K +QK F 
Sbjct: 229 IEDAAKAVNAVVAMDEDLLEEVTSLVEWPVTLTATFEEAFLDVPAEALIYTMKDDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
              + G L N F+ VSNI++ D  + ++ GN +VV  RL DA  F++ D+          
Sbjct: 289 LLDQNGKLLNKFLFVSNIESKD-PSVVISGNEKVVRPRLADAQFFFETDK---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      K L+ R+  LD   V+F  ++GT  ++  RI  L   IA+ + AD AL 
Sbjct: 338 ----------KKTLESRLESLD--SVLFQKQLGTLKDKSQRISELAGYIAEQLGADKALA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EF ++QG +G  YA    E      A  E   PR   +N+PT+
Sbjct: 386 ARAGLLSKTDLMTEMVMEFTDVQGVMGMHYARHDGEAEDVAVAQNEQYMPRFAGDNLPTS 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP------- 524
            IS  V++ADK DTL+  + I + P G KDP+ALRRA +G +RI++E ++ +        
Sbjct: 446 LISCAVAIADKFDTLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKQLPLDILDLVAK 505

Query: 525 --------LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                   L+      ++  F   R + +  D  I  D+I+A+L       +     +K 
Sbjct: 506 SQTLFGEKLTNLNVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKA 565

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           ++ F +    E    + KR+  ILA   K N     ++    L  +AEK L + ++ F T
Sbjct: 566 VSHFRTLDAAESLAAANKRVSNILA---KNNITTQGDVDQSLLSDDAEKVLASQVAKFAT 622

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +        Y +    L  I + ++ FFD V+V  DD  V+ NRL+LL  +  + L + 
Sbjct: 623 DLAPLYSDGNYQEALSQLAGIRDSVDNFFDNVMVMADDEAVKQNRLALLSQLSGLFLEIA 682

Query: 697 NVQ 699
           ++ 
Sbjct: 683 DIS 685


>gi|311277514|ref|YP_003939745.1| glycyl-tRNA synthetase, beta subunit [Enterobacter cloacae SCF1]
 gi|308746709|gb|ADO46461.1| glycyl-tRNA synthetase, beta subunit [Enterobacter cloacae SCF1]
          Length = 689

 Score =  628 bits (1620), Expect = e-177,   Method: Composition-based stats.
 Identities = 210/726 (28%), Positives = 334/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDSAGLAHGGVEWFAAPRRLALKVAA 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP V       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAVAQAFDASGHPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRW  +        ++RP+ ++  +L +E  
Sbjct: 119 RAHVKGESAQALLPNMVATALAKLPIPKLMRWGASD-----VHFVRPVHTVTMLLGSE-- 171

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
              +I   +  I    +  GHRF       +   D Y +  LE   V+ D E R+  I  
Sbjct: 172 ---VIPATILGIASDRVIRGHRFMGEPEFTIDHADQYPQILLERGKVIADYEQRKATIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAARKIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLKVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI + D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDAAGKLLPNFIFVANIVSKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RLD   V+F  ++GT  ++  RI  L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDHLPRLDT--VLFQQQLGTLRDKTDRIEALSGWIARQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGIMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NLVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLSLDLQSLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGEKLTNASVVDDVIDFMLGRFRAWYQDEGYAVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F +         + KR+  ILA   K +  ++  ++   L    E  L   I    
Sbjct: 566 AVTYFRTLDAASALAAANKRVSNILA---KSDEVLNERVNAATLKDPEEVALALQIVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + EP++ FF++V+V VDD+E+R NRLS+L+ ++ + L V
Sbjct: 623 DKLEPYFAQGRYQEALVELAELREPVDAFFEKVMVMVDDKELRINRLSMLEKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|295098692|emb|CBK87782.1| glycyl-tRNA synthetase beta chain [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 689

 Score =  628 bits (1619), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/726 (27%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKIEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAEALLPDMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  +    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDTVIPATILGVASDRVIRGHRFMGESEFTIDNADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEDAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D  + I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PSQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI  L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIAELSGWIAREIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNAKVVDDVIDFMLGRFRAWYQDEGYSVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KSDETLNERVNAATLKEPEEISLAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + + I+ FF++V+VNV+D+E+R NRLS+L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQEALVELAELRDVIDAFFEKVMVNVEDKELRINRLSMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|312968099|ref|ZP_07782310.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 2362-75]
 gi|312287358|gb|EFR15267.1| glycyl-tRNA synthetase beta subunit [Escherichia coli 2362-75]
          Length = 682

 Score =  628 bits (1619), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/718 (28%), Positives = 333/718 (46%), Gaps = 61/718 (8%)

Query: 7   EIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEK 66
           EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  L+   P++
Sbjct: 2   EIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVANLAEAQPDR 61

Query: 67  IEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRL 119
             E+ GP +       G   KA +G+ R  G+      ++     KG+  L         
Sbjct: 62  EIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAHVKGES 119

Query: 120 IEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLD 179
            E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L      +K+I   
Sbjct: 120 TEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL-----GDKVIPAT 169

Query: 180 LKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHRLASA 238
           +  I    +  GHRF       + + D Y   L     V+ D E R+  I  DA   A  
Sbjct: 170 ILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKADAEEAARK 229

Query: 239 VGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV 298
           +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F     +G 
Sbjct: 230 IGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYFPVYANDGK 289

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+                 
Sbjct: 290 LLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR----------------- 331

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
               K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV    RA +LS
Sbjct: 332 ---KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNHATRAGLLS 386

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           K DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++  ++
Sbjct: 387 KCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALA 446

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------- 531
           +ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E+       
Sbjct: 447 IADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGD 506

Query: 532 --------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSS 583
                    ++I F   R + +  D     D I+A+L             +K ++ F + 
Sbjct: 507 KLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKAVSHFRTL 566

Query: 584 AKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMD 643
                   + KR+  ILA   K +  +S  ++   L    E +L   +      ++    
Sbjct: 567 EAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLRDKLEPYFA 623

Query: 644 HKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V ++  +
Sbjct: 624 EGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRVADISLL 681


>gi|292490092|ref|YP_003532987.1| glycyl-tRNA synthetase subunit beta [Erwinia amylovora CFBP1430]
 gi|292901099|ref|YP_003540468.1| glycine-tRNA synthetase subunit beta [Erwinia amylovora ATCC 49946]
 gi|291200947|emb|CBJ48086.1| glycine-tRNA synthetase, beta subunit [Erwinia amylovora ATCC
           49946]
 gi|291555534|emb|CBA24085.1| Glycyl-tRNA synthetase, beta subunit [Erwinia amylovora CFBP1430]
 gi|312174286|emb|CBX82539.1| Glycyl-tRNA synthetase, beta subunit [Erwinia amylovora ATCC
           BAA-2158]
          Length = 689

 Score =  628 bits (1619), Expect = e-177,   Method: Composition-based stats.
 Identities = 201/726 (27%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  L   L   G+ +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAESFAANLTAELDAAGLAHGEVSWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSAAQPDREVEKRGPAIQAAFDANGVATKAAEGWARGCGITVDQAERL--STDKGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             R      + +L  ++  ++ K+P PK MRW       S   ++RP+ ++  +L     
Sbjct: 119 RARVTGERTQALLPAMIANSLTKLPIPKLMRWGA-----SEVQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +++I  ++  +    +  GHRF       +   D Y +  LE   V  D   R+  I  
Sbjct: 169 GDELIPANILGVDSARVIRGHRFMGEPAFTIDHADQYPQILLERGKVQADYAARKATIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G     +  LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGVADLNDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
               + G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDKAGKLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNSDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       + L+  + RL+   V+F  ++GT   +  RI+ L   +A  I ADV  
Sbjct: 339 -----------KRRLEDNLPRLET--VLFQKELGTLRAKTDRIQALSGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDVLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLSE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 +I F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGNKLSNAKAVDEVIDFMLGRFRAWYQEEGHSVDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAASLAAANKRVSNILA---KATEPLNDSVQASLLKENEEIKLATYVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY +    L  + E ++ FFD+V+VN +++EVR NRL+LL  ++ + L V
Sbjct: 623 SKLQPFFAEGRYQEALIELAQLREAVDNFFDKVMVNAEEKEVRINRLTLLAKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|332304394|ref|YP_004432245.1| glycyl-tRNA synthetase, beta subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171723|gb|AEE20977.1| glycyl-tRNA synthetase, beta subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 692

 Score =  628 bits (1619), Expect = e-177,   Method: Composition-based stats.
 Identities = 204/720 (28%), Positives = 345/720 (47%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           + L+EI +EE+P +   K A+  +  +   L    + Y ++  + +P RL + +  L+  
Sbjct: 5   NLLIEIGTEELPPKALCKLAQAFADNMQNALDAAELKYASVEWFASPRRLAVNVIDLAEQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +K+ E+ GP V       G   KA  G+ RS G+      ++     KG+  L     
Sbjct: 65  QEDKLIEKKGPAVSVAFDEAGQATKAAQGWARSNGITVEQAERL--TTDKGEWLLFKGES 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
               I  +L  ++  A++K+P PK+MRW +     S+  +IRP+ ++  +  A+     +
Sbjct: 123 KGETISSLLPPMIDGALKKLPIPKAMRWGS-----SSIQFIRPVHTVTILFGAD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRL 235
           I  ++  I    +  GHRFH      +   + Y+  LE   VL D   R+  I       
Sbjct: 173 IKGNILGIDSDRVVQGHRFHGEKQFSLAHANDYLAQLEAHYVLADFAARKAKIQQQVKAT 232

Query: 236 ASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR 295
           A         + +LL+E+  LVEW  V   SFD+ +L +P+E +  T+K +QK F    +
Sbjct: 233 AQKENAVADMNDELLDEVTALVEWPVVLTASFDESFLEVPKEALIYTMKDDQKYFPLLDQ 292

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
            G L + F+ V+NI++ D    I+ GN +V+  RL DA  F+  D+              
Sbjct: 293 NGQLKSRFVFVTNIESKD-PKQIISGNEKVIRPRLADAEFFFNTDK-------------- 337

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAI 415
                    L+ R+  L    V+F  ++GT  E+  RI  L   IA ++D+D AL  RA 
Sbjct: 338 ------KTTLESRLESLKT--VLFQKQLGTLYEKSQRIAELAGTIASMLDSDAALASRAG 389

Query: 416 VLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISI 475
           +LSK DL T +V EFP++QG +G  YA    E+ +   A+ E   PR   + +PT+ IS 
Sbjct: 390 LLSKTDLMTNMVMEFPDVQGVMGMHYAKNDGESDAVALALNEQYMPRFAGDQLPTSHISS 449

Query: 476 TVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE----- 530
            V+LADK+DTL+  + I + P G KDP+ALRRA +G++RI +E K+ + L++ ++     
Sbjct: 450 AVALADKIDTLVGIFGIGQVPKGDKDPFALRRAAIGVLRISVEMKLPLDLTELVQASIDS 509

Query: 531 -----------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +  D++I  D+I+A+              I+ ++ 
Sbjct: 510 FADKLTHVDDLTSQVVDFILGRFRAWYQDQNIDIDVIQAVAARRPTKPADFAARIEAVSG 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F   + G     + KR+  ILA   K     S  I P     E E  L   ++     + 
Sbjct: 570 FKRLSSGLALASANKRVANILA---KNKITGSTNIDPSLFESEHETALADALNSIEATVN 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             ++   Y  + D L ++   ++ FFD V+V  +D +VR+NRL+LL  ++ + L+V ++ 
Sbjct: 627 AFVNDANYQGVFDQLATLHVKVDDFFDNVMVMAEDEKVRNNRLALLSKLRTLFLLVADIS 686


>gi|300725252|ref|YP_003714581.1| glycine tRNA synthetase subunit beta [Xenorhabdus nematophila ATCC
           19061]
 gi|297631798|emb|CBJ92519.1| glycine tRNA synthetase, beta subunit [Xenorhabdus nematophila ATCC
           19061]
          Length = 694

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/722 (28%), Positives = 337/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFEAELNNANLGHGEVSWFAAPRRLALKVANLAAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L   + 
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQAERMVTD--KGEWLLYRAQV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             R  +D+L  +V  ++ K+P PK MRW    +      ++RP+ ++  +L  +     +
Sbjct: 123 KGREAKDLLAEMVSSSLGKLPIPKLMRWGDKET-----QFVRPVHTVTMLLGRD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           +D ++  I    I  GHRF       +++ + Y   L+E   V+ D E R+  I  DA R
Sbjct: 173 VDGEILGIKSDRIIRGHRFMGEAEFTIENAEQYPAILQERGRVIADYEARKAIIKRDAER 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+ +G       +LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAAQLGGVADLSDNLLEEVASLVEWPVVLTAKFEEKFLEVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++SD    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 NSGKLMANFIFVTNIESSD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQKQLGTLRDKTDRIQALAGWIAEQIGADVEHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL   +V EF + QG +G  YA    E      A+ E  +PR   +++P+  +S
Sbjct: 390 GLLSKCDLMANMVFEFTDTQGVMGMHYARHDGEAEDVALALNEQYQPRFSGDDLPSTGVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E K+ + L    E+   
Sbjct: 450 CAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLQTLAEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGDKLTNEKAVDDVVEFMLGRFRAWYQELGYSVDTIQAVLARRPTQPADFDARMKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA  E+K   ++  +    L    E +L   +      + 
Sbjct: 570 FRTLDEAVSLAAANKRVSNILAKSEEK---LNDSVQASVLKAAEEIQLATHLVVLKEKLT 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y      L S+ E ++ FFD V+V  +D +VR NRL+LL  ++++ L V ++ 
Sbjct: 627 PLFAESNYQDALVELVSLREVVDAFFDNVMVMDEDSQVRINRLTLLSELRDLFLRVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|227326603|ref|ZP_03830627.1| glycyl-tRNA synthetase subunit beta [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 689

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 202/724 (27%), Positives = 331/724 (45%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L    + + ++  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLAHGDVSWFAAPRRLALKVAR 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVEQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRWS   +      ++RP+ ++  +L     
Sbjct: 119 RAHAKGEQAQALLAGMVSTALSKLPIPKLMRWSDKET-----QFVRPVHTVTMLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            E++I   +  I       GHRF       + + + Y +  LE   V+ D + R+  I  
Sbjct: 169 GEELIPGQVLGIDSARTIRGHRFMGEAEFTIDNAEQYPQILLERGKVVADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++G+  ++  RI+ L   +A  I A+V  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGSLRDKTDRIQALAGWVAGQIGANVDH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 AKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+D+L   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDSLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLSNAKVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F S         + KR+  IL    K    ++  ++   L   AE  L   +    
Sbjct: 566 AVSHFRSLDAAAALAAANKRVSNILT---KSTDTLNESVNAAVLKDAAEITLATHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +       RY +    L S+ EP++ FFDQV+V  +D +VR NRL+LL  ++ + L V
Sbjct: 623 DKLTPLFAEGRYQEALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|310765834|gb|ADP10784.1| glycyl-tRNA synthetase subunit beta [Erwinia sp. Ejp617]
          Length = 689

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 204/726 (28%), Positives = 334/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  L   L   G+ +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAESFAANLTAELDAAGLAHGEVSWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSAAQPDREVEKRGPAIQAAFDANGVATKAAEGWARGCGITVDQAERL--STDKGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             R      + +L  +V  ++ K+P PK MRW       S   ++RP+ ++  +L     
Sbjct: 119 RARVTGERTQLLLPAMVATSLAKLPIPKLMRWGA-----SEVQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++  ++  I       GHRF       +   D Y +  LE   V  D E R+  I  
Sbjct: 169 GDELVPANILGIDSARTLRGHRFMGEPAFTIDHADQYPQILLERGKVQADYEARKAIIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
               + G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDKAGKLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNSDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       + L+  + RL+   V+F  ++GT   +  RI+ L   +A  I ADV  
Sbjct: 339 -----------KRRLEDNLPRLET--VLFQKELGTLRAKTDRIQALAGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 +I F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGNKLSNAKAVDEVIDFMLGRFRTWYQEEGHSVDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAASLAAANKRVSNILA---KATEPLNDSVQASLLKENEEIKLATYVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN +D+EVR NRL+LL  ++ + L V
Sbjct: 623 SKLQPFFAEGRYQDALIELAQLRETVDNFFDKVMVNAEDKEVRINRLTLLARLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|259910253|ref|YP_002650609.1| glycyl-tRNA synthetase subunit beta [Erwinia pyrifoliae Ep1/96]
 gi|224965875|emb|CAX57408.1| Glycyl-tRNA synthetase beta subunit [Erwinia pyrifoliae Ep1/96]
 gi|283480370|emb|CAY76286.1| glyS [Erwinia pyrifoliae DSM 12163]
          Length = 689

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 201/726 (27%), Positives = 334/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  L   L   G+ +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAESFAANLTAELDAAGLPHGEVSWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSAAQPDREVEKRGPAIQAAFDANGVATKAAEGWARGCGITVDQAERL--STDKGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             R      + +L  ++  ++ K+P PK MRW       S   ++RP+ ++  +L     
Sbjct: 119 RARVTGERTQVLLPAMIATSLAKLPIPKLMRWGA-----SEVQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            ++++  ++  I       GHRF       +   D Y +  LE   V  + E R+  I  
Sbjct: 169 GDELVPANILGIDSARTLRGHRFMGEPAFTIDHADQYPQILLERGKVQANYEVRKAIIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
               + G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDKAGKLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNSDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       + L+  + RL+   V+F  ++GT   +  RI+ L   +A  I ADV  
Sbjct: 339 -----------KRRLEDNLPRLET--VLFQKELGTLRAKTDRIQALAGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 +I F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGNKLSNAKAVDEVIDFMLGRFRTWYQEEGHSVDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAASLAAANKRVSNILA---KATEPLNDSVQASLLKENEEIKLATYVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN +D++VR NRL+LL  ++ + L V
Sbjct: 623 SKLQPFFAEGRYQDALIELAQLRETVDNFFDKVMVNAEDKKVRINRLTLLAKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|254483305|ref|ZP_05096536.1| glycyl-tRNA synthetase, beta subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214036400|gb|EEB77076.1| glycyl-tRNA synthetase, beta subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 692

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 201/726 (27%), Positives = 344/726 (47%), Gaps = 61/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +   L+E+ +EE+P +            +   LK+  + +  +  + +P RL + +  
Sbjct: 1   MSNETLLIELGTEELPPKALKSLGLAFRDGITAGLKQRELGFGEVSWFASPRRLAVQIAQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           +     +K  E LGP +       G    A  GF +  G+      +I+    KG     
Sbjct: 61  VQTQGEDKDIEVLGPPIDRARDSEGNWTPAASGFAKKQGVAAQDLQEIE--TPKGTRLGL 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
              +      D L  I+   I  +P PK MRW       S   ++RP++ ++ +L     
Sbjct: 119 KKTEAGLHTSDCLNDIIVETIAGLPIPKRMRWGA-----SRVEFVRPVQWLIAML----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            EK     +  IP GN T GHRFH+   I ++  D Y   L  A V+ + + R+  I   
Sbjct: 169 GEKFDHGKILGIPTGNTTRGHRFHSSGDILLEKADDYEEVLANAHVVANFDKRQAMIREQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
               ASAV    V D DLL+E+ GLVEW     GSF++++L +P E +  ++K +QK F 
Sbjct: 229 VEAEASAVNASAVIDPDLLDEVTGLVEWPVALTGSFEERFLEVPAEALISSMKEHQKYFH 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
                G L   FI ++NI++ D    ++ GN RV+  RL DA  F++ D+          
Sbjct: 289 LVDANGELKPNFITLANIESKD-PVQVIAGNERVIRPRLADAAFFFETDK---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                       PL +R A+L+   V+F  K+GT  ++  R++ L   +A++I AD    
Sbjct: 338 ----------KTPLAKRAAKLET--VIFQQKLGTLADKARRVQKLAGSLARMIGADADKA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
           +R+ +L+KADL T++V+EF ++QG  G  YA+   E+     AI +   P+   + +P +
Sbjct: 386 ERSALLAKADLVTDMVQEFSDMQGVAGSYYALHDGEDAEVAAAIAQQYWPKFAGDRLPES 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE- 530
             +  + LAD+LDTL+  + I + P+GSKDP+ALRRA+L ++RII+E K+++ L   +E 
Sbjct: 446 NTACALGLADRLDTLVGIFGIGQPPTGSKDPFALRRASLAVLRIIVEKKLELDLRDCLEL 505

Query: 531 --------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                            +  +  +R + +  + +I  ++  A+        L I   +  
Sbjct: 506 ATQQYPQDLLAEGTTDQVFDYMIERFRAWYEEENIPVEVFRAVSARRISQPLDIQQRVLA 565

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +N F    +      + KR+  IL   +  N     E+    L   AEK L   +S   T
Sbjct: 566 VNAFSQLPEASALAAANKRVSNIL--GKLSNDHSFGEVRVNLLQEAAEKELTENLSALST 623

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
                ++   Y      L  +  P++ FFD+V+VN ++  +R+NRL+LL+ +++  L V 
Sbjct: 624 IASGHLEKGEYSAALASLAGLRAPVDRFFDEVMVNAENEALRNNRLNLLKALRDQFLEVA 683

Query: 697 NVQKIV 702
           ++ ++V
Sbjct: 684 DISQLV 689


>gi|167549108|ref|ZP_02342867.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325814|gb|EDZ13653.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 689

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|148545333|ref|YP_001265435.1| glycyl-tRNA synthetase subunit beta [Pseudomonas putida F1]
 gi|166227920|sp|A5VWJ1|SYGB_PSEP1 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|148509391|gb|ABQ76251.1| Glycine--tRNA ligase [Pseudomonas putida F1]
          Length = 684

 Score =  627 bits (1618), Expect = e-177,   Method: Composition-based stats.
 Identities = 211/725 (29%), Positives = 344/725 (47%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      E     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALTSLGEAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L    P++     GP +       G   +A  GF +  G+      +I +   K      
Sbjct: 61  LDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGV---ELAEIDQSGPK---LRF 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
               P +   D+L TIV  ++  +P PK MRW+ +        ++RP + ++ +L     
Sbjct: 115 SQHIPGKATTDLLPTIVEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I   
Sbjct: 165 GDQVVDCTILSQKAGRESRGHRFHHPETVVITTPANYVEDLRKAHVLADFAERRELISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 TAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D    IVQGN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDSEGKLLPRFITVANIESRD-PKQIVQGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL+    RL   +VVF A++GT  ++  R+  L   +A LI  D    
Sbjct: 334 ----------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSKLAAFVAPLIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P  
Sbjct: 382 GRAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                            ++ F  DRL+    D  I      ++   +  + L     ++ 
Sbjct: 502 AVKQFGAKVKAPGLADQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|304415609|ref|ZP_07396219.1| glycine tRNA synthetase beta subunit [Candidatus Regiella
           insecticola LSR1]
 gi|304282541|gb|EFL91094.1| glycine tRNA synthetase beta subunit [Candidatus Regiella
           insecticola LSR1]
          Length = 690

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 335/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     A+  +   I  L +  + + N++ + TP RL L +  LS  
Sbjct: 6   TFLVEIGTEELPPKALRSLAQSFADHFITELNDAHLSHGNLKWFATPRRLALQVTDLSTT 65

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++I E+ GP +       G   KA + +    G+      +++   +KG+  L   + 
Sbjct: 66  QADRIIEKRGPAITQAYDALGKATKAAESWACGCGITLDQAERLR--TEKGEWLLYRAQI 123

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +    +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L       ++
Sbjct: 124 KGQSATSLLPRLVNTALSKLPIPKLMRWGDKST-----QFVRPVHTVTLLL-----GNEL 173

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHY-IRDLEEAMVLLDPECRRNAILNDAHR 234
           I   L  +    +  GHRF     + + + + Y    L    V+ D E R+  I +   +
Sbjct: 174 IPGTLLGVDSARLIRGHRFMGEATLTLDNAEQYRQILLTRGSVIADYETRKAQIKSQIEQ 233

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G     D+DLLEE+  LVEW  V   SF+KK+L +P E +  T+K +QK F    
Sbjct: 234 TAQTLGGIADIDEDLLEEVTSLVEWPVVLTASFEKKFLLVPAEALVHTMKADQKYFPVYD 293

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           + G L++ FI V+NI + D    I+ GN +V+  RL DA  F+  D+             
Sbjct: 294 QVGQLSSNFIFVANIASKD-PQQIIAGNEKVIRPRLADAEFFFNTDRQ------------ 340

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   KPL   + RL+   V+F  ++GT  ++  RI  L   IA+ I AD+    RA
Sbjct: 341 --------KPLLDYLPRLE--SVLFQQQLGTLRDKTDRISALSGWIAEQIGADIPHAIRA 390

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF E QG +G  YA    E+     A+ E   PR   + +P+  +S
Sbjct: 391 GLLSKCDLMTNMVFEFTETQGMMGMHYARHDGEDEQVALALYEQYLPRFSGDLLPSKPVS 450

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL+  + I + P G KDP+ALRRA LG++RII  NK+ + L    +    
Sbjct: 451 CALAIADKIDTLVGIFGIGQPPKGDKDPFALRRAALGVLRIITLNKLPLDLQTLSQQAER 510

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +  +     D I+A+L             IK ++ 
Sbjct: 511 LYGSKLINKKGVNEVVEFMLGRFRAWYQEEGHSVDTIQAVLACHPTKPADFDARIKAVSH 570

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    +  ++    L   AE  L   +      ++
Sbjct: 571 FRTLDAAVALTAANKRVSNILA---KSTDILPDDVDVSLLTDPAELTLATDLIALSDQLE 627

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 RY +    L ++ E ++ FFD V+V V+D  +R NRL+LL  ++ + L + ++ 
Sbjct: 628 PLFASGRYQEALSKLAALREVVDRFFDNVMVMVEDNSMRINRLTLLNKLRALFLKIADIS 687

Query: 700 KI 701
            +
Sbjct: 688 LL 689


>gi|168232493|ref|ZP_02657551.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194468955|ref|ZP_03074939.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194455319|gb|EDX44158.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333256|gb|EDZ20020.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 689

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|296100579|ref|YP_003610725.1| glycyl-tRNA synthetase subunit beta [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055038|gb|ADF59776.1| glycyl-tRNA synthetase subunit beta [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 689

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 202/726 (27%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKIEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGERAEALLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  +    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDTVIPATILGVASDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI  L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIAELSGWIAREIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KSDETLNERVNAATLKEPEEIALAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + + I+ FF++V+VNV+D+++R NRLS+L+ ++ + L V
Sbjct: 623 DKLEPYFAEGRYQEALVELAELRDVIDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|253690527|ref|YP_003019717.1| glycyl-tRNA synthetase, beta subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|259511928|sp|C6DII7|SYGB_PECCP RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|251757105|gb|ACT15181.1| glycyl-tRNA synthetase, beta subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 689

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/724 (28%), Positives = 331/724 (45%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLAHGEVSWFAAPRRLALKVAR 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAIAQAFDAEGKTTKAAEGWARGCGITVEQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  ++  A+ K+P PK MRWS   +      ++RP+ ++  +L     
Sbjct: 119 RAHAKGEQAQALLAGMISTALSKLPIPKLMRWSDKET-----QFVRPVHTVTMLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +++I   +  I       GHRF       + S D Y +  LE   V+ D + R+  I  
Sbjct: 169 GDELIPGQVLGIHSARTLRGHRFMGEAEFTIDSADQYPQILLERGKVVADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNSGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGAKLTNANVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F S         + KR+  ILA   K    ++  ++   L   AE  L   +    
Sbjct: 566 AVSHFRSLDAAAALAAANKRVSNILA---KSTDTLNESVNAAVLKDAAEITLATHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +       RY +    L S+ EP++ FFDQV+V  +D +VR NRL+LL  ++ + L V
Sbjct: 623 DKLTPLFAEGRYQEALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|23013833|ref|ZP_00053688.1| COG0751: Glycyl-tRNA synthetase, beta subunit [Magnetospirillum
           magnetotacticum MS-1]
          Length = 688

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 274/720 (38%), Positives = 415/720 (57%), Gaps = 53/720 (7%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M +FLLEI+SEEIPARMQ +AA+DL  ++   L + G+ +  +R Y TP RL L ++GL 
Sbjct: 1   MAEFLLEIFSEEIPARMQARAADDLRGMVTDGLAKNGITFDAVRSYVTPRRLVLVIEGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
              P+  EE+ GPRVG+  +A++GFL+STG+      Q  +D  KG  Y AV+ +  R  
Sbjct: 61  LAGPDVSEEKRGPRVGSPAQAMEGFLKSTGMSVEQLEQ--RDTGKGVFYFAVINRKGRPT 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +VL  +V   +   PWPKS RW       ++  W+RP++SIL +         ++ ++ 
Sbjct: 119 AEVLSEVVEATMAAFPWPKSQRWGA-----NSIRWVRPIQSILALFEG-----HVVPVEF 168

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
                G++T GHRF AP   +V+    Y+  L  A V+LDP  RR+AIL+ A  LA+A G
Sbjct: 169 GPAKSGDMTCGHRFLAPESFRVKDFADYLARLRHAKVMLDPVERRHAILSGAEALAAAEG 228

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           L L  D  LL E+ GLVEW    +GS D K++ +P E++  +++ +QK F     +G LA
Sbjct: 229 LTLKADDGLLAEVTGLVEWPVPLVGSIDDKFMDVPAEVLITSMRAHQKYFSLLKADGSLA 288

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           + F+++SN++ +DGG+A+V GN RV+ ARL DA  FW  D+                   
Sbjct: 289 SRFVVISNMETTDGGSAVVAGNQRVLRARLSDAKFFWDTDR------------------- 329

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
             + L+ R+ +L      F+A +GT  ++V RI  L   IA +I AD AL +RA  L+KA
Sbjct: 330 -KQRLESRLPKLAER--TFYASLGTVADKVERIAGLAGNIADMIGADKALAERAARLAKA 386

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA+   EN    DAI  H  P+GP ++ PT  +S+ V+LA
Sbjct: 387 DLSSELVGEFPELQGLMGRYYALNDGENPLVADAIAAHYAPQGPSDSCPTAPVSVAVALA 446

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE---------- 530
           DK+D+L+ F+AINE+P+GSKDP+ALRRA LGIIR++LEN + +PLSQ I           
Sbjct: 447 DKIDSLVGFFAINERPTGSKDPFALRRAALGIIRLVLENGLRLPLSQVIFLASGHFKATL 506

Query: 531 -------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPEN-DNLLTIVDLIKHLNEFFS 582
                   ++L+ FF DRL + L ++ +RHDLI AI      D+L+ ++  +  L  F +
Sbjct: 507 VQAPGEVARDLLNFFADRLAVALKEKGVRHDLITAIFSLGGEDDLVRLLKRVDALGAFLA 566

Query: 583 SAKGEKFLLSAKRIFQILAIEEKKNREI-SLEISPQYLLLEAEKRLYAVISDFGTHIQES 641
           S  G   L++ +R   I+ IEEKK+  + +       L  + EK L   +S  G  ++ +
Sbjct: 567 SDDGANLLIAYRRAANIVRIEEKKDATLFTGSADLALLRQDEEKALELALSKVGQEVKNA 626

Query: 642 MDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  + +      L  +  P++ FFD+V VN D+ ++R NRL LL  I + +  + +  K+
Sbjct: 627 LATEDFAAAMAALARLRRPVDAFFDKVTVNADEADLRVNRLKLLAMIGSAMGGLADFSKV 686


>gi|157368319|ref|YP_001476308.1| glycyl-tRNA synthetase subunit beta [Serratia proteamaculans 568]
 gi|166980041|sp|A8G7U0|SYGB_SERP5 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|157320083|gb|ABV39180.1| glycyl-tRNA synthetase, beta subunit [Serratia proteamaculans 568]
          Length = 689

 Score =  627 bits (1617), Expect = e-177,   Method: Composition-based stats.
 Identities = 201/720 (27%), Positives = 325/720 (45%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAEAFAANFTAELDSANLEHGEVSWFAAPRRLALKVANLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L AE     +
Sbjct: 123 KGQSAQALLAGMVSNSLAKLPIPKLMRWGDSD-----VQFVRPVHTVTMLLGAE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I       GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSARTVRGHRFMGEAEFTIDNADQYPQILLERGKVIADYETRKAMIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            AS +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AASTIGGKADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 AAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAGQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPESLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            ++++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CSLAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLTLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNAKVVDEVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLEAAAALAAANKRVSNILA---KSTDTLNDRVHASVLKEAAEIQLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y      L  + EP++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PYFAAGNYQDALVELADLREPVDAFFDNVMVMAEDEAVRVNRLTLLSKLRELFLQVADIS 686


>gi|261341815|ref|ZP_05969673.1| hypothetical protein ENTCAN_08299 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316188|gb|EFC55126.1| glycyl-tRNA synthetase, beta subunit [Enterobacter cancerogenus
           ATCC 35316]
          Length = 689

 Score =  627 bits (1616), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/726 (27%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKIEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAEALLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  +    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDTVIPATILGVASDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEQRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARQIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI  L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIAELSGWIAREIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNAKVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLDAAAALAAANKRVSNILA---KSDETLNERVNAATLKEPEEIALAMQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + E I+ FF++V+VNV+D+E+R NRL++L+ ++ + L V
Sbjct: 623 DKLEPFFAEGRYQEALVELSELREAIDAFFEKVMVNVEDQELRINRLTMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|168465046|ref|ZP_02698938.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818524|ref|ZP_02830524.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|195632214|gb|EDX50698.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|205344573|gb|EDZ31337.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320088072|emb|CBY97834.1| Glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 689

 Score =  627 bits (1616), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|260914511|ref|ZP_05920980.1| glycyl-tRNA synthetase [Pasteurella dagmatis ATCC 43325]
 gi|260631612|gb|EEX49794.1| glycyl-tRNA synthetase [Pasteurella dagmatis ATCC 43325]
          Length = 689

 Score =  627 bits (1616), Expect = e-177,   Method: Composition-based stats.
 Identities = 212/722 (29%), Positives = 352/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +  +  +  P RL + + GL+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENVELELNQAGLTFDKVEWFAAPRRLAVKVLGLATS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      +I  D  KG+  +     
Sbjct: 65  QPSKQIEKRGPAVSAAFDSEGKPTKAAEGWARGCGINVEQAERIATD--KGEWLVHRATI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++LK IV  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLKDIVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +  G    GHRF   H  ++   D Y   L+E   V+ D   R+  IL  A  
Sbjct: 173 IEGEILGVTSGTTIRGHRFLGEHEFQISHADQYPALLKEKGSVVADFNERKALILAKAQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEEDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           +EG L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KEGKLLPHFIFVSNINPED-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADETKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V+LADK DTL   + I ++P GS DP+ALRRA LG++RII+E  + + L + ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQQPKGSADPFALRRAALGVLRIIVEKNLPLDLEEIVKKSAA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       + ++ F   R + +  D  I  D+I+++L             ++ ++ 
Sbjct: 510 LFGDRLTNANVVEEVVDFMLGRFRAWYQDEGIAVDVIQSVLARRPTKPSDFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   E+   I     +   EK L   +      + 
Sbjct: 570 FRTLEAAEALAAANKRVSNILA---KVEGELPATIDTVLCVENTEKVLAEQVIALQAELT 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y    D L ++ EP++ FFD V+VNV+D+++R NRL++L  ++N+ L V ++ 
Sbjct: 627 PLFAKGEYQVALDRLAALREPVDTFFDNVMVNVEDQKLRQNRLAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|313647572|gb|EFS12022.1| glycyl-tRNA synthetase beta subunit [Shigella flexneri 2a str.
           2457T]
          Length = 682

 Score =  626 bits (1615), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/718 (28%), Positives = 333/718 (46%), Gaps = 61/718 (8%)

Query: 7   EIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEK 66
           EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  L+   P++
Sbjct: 2   EIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVANLAEAQPDR 61

Query: 67  IEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRL 119
             E+ GP +       G   KA +G+ R  G+      ++     KG+  L         
Sbjct: 62  EIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAHVKGES 119

Query: 120 IEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLD 179
            E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L      +K+I   
Sbjct: 120 TEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL-----GDKVIPAT 169

Query: 180 LKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHRLASA 238
           +  I    +  GHRF       + + D Y   L     V+ D E R+  I  DA   A  
Sbjct: 170 ILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKADAEEAARK 229

Query: 239 VGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV 298
           +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F     +G 
Sbjct: 230 IGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYANDGK 289

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+                 
Sbjct: 290 LLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR----------------- 331

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
               K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV    RA +LS
Sbjct: 332 ---KKRLEDNLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAEQIGADVNHATRAGLLS 386

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           K DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++  ++
Sbjct: 387 KCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALA 446

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------- 531
           +ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E+       
Sbjct: 447 IADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGD 506

Query: 532 --------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSS 583
                    ++I F   R + +  D     D I+A+L             +K ++ F + 
Sbjct: 507 KLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKAVSHFRTL 566

Query: 584 AKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMD 643
                   + KR+  ILA   K +  +S  ++   L    E +L   +      ++    
Sbjct: 567 EAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLRDKLEPYFA 623

Query: 644 HKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V ++  +
Sbjct: 624 EGRYQDALVELAELREPVDAFFDKVMVMVDDKELRLNRLTMLEKLRELFLRVADISLL 681


>gi|168235257|ref|ZP_02660315.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194736702|ref|YP_002116587.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|238689772|sp|B4TZ49|SYGB_SALSV RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|194712204|gb|ACF91425.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197291494|gb|EDY30846.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 689

 Score =  626 bits (1615), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|198244903|ref|YP_002217613.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205354738|ref|YP_002228539.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858892|ref|YP_002245543.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238690327|sp|B5FLC9|SYGB_SALDC RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238690461|sp|B5R4P2|SYGB_SALEP RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238690542|sp|B5RGM2|SYGB_SALG2 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|197939419|gb|ACH76752.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205274519|emb|CAR39556.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710695|emb|CAR35056.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326625398|gb|EGE31743.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629878|gb|EGE36221.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 689

 Score =  626 bits (1615), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLSVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|39995686|ref|NP_951637.1| glycyl-tRNA synthetase subunit beta [Geobacter sulfurreducens PCA]
 gi|81832117|sp|Q74FM7|SYGB_GEOSL RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|39982449|gb|AAR33910.1| glycyl-tRNA synthetase, beta subunit [Geobacter sulfurreducens PCA]
 gi|298504697|gb|ADI83420.1| glycyl-tRNA synthetase, beta subunit [Geobacter sulfurreducens
           KN400]
          Length = 687

 Score =  626 bits (1615), Expect = e-177,   Method: Composition-based stats.
 Identities = 216/727 (29%), Positives = 341/727 (46%), Gaps = 68/727 (9%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +  LEI +EEIPA    KA  D+  I+   L+   + +  ++ + TP RL L +KGL
Sbjct: 1   MSKELFLEIGTEEIPAGFLPKAMADMEAIVTKELENARLAFGEVKTFATPRRLALVVKGL 60

Query: 60  SPHSPEKIEERLGP-------RVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
               P+     LGP         G   KA +GF R  G+   S   +    +KG+   AV
Sbjct: 61  PTVQPDAEITALGPARNIAFGPDGTPSKAAEGFARGQGVDVASLTLV--STEKGEYVAAV 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
            ++  R + D+L  I+P  +  +P+ KSMRW+          + RP+  I+ +       
Sbjct: 119 RKESGRPVPDLLAEILPRLVGGIPFRKSMRWADLD-----VRFARPIHWIVALF-----D 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
             ++      +  GN++ GHRF A  P  V+   HY+ + E   V+ DPE R+  I  + 
Sbjct: 169 GVVVPFAFGNVQSGNVSRGHRFMANQPFPVRDFAHYLDECERHFVIPDPERRKETIRREI 228

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
           HR+A   G  L+ D+ LL+E+  LVE+  V  G+F   +L +P E++  +++++Q+ F  
Sbjct: 229 HRVAKTAGGHLLPDEGLLDEVAYLVEYPSVVHGTFSPDFLKVPREVLITSMRSHQRYFSI 288

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
               G L   FI ++N    D  + +V+GN RV+ ARL DA  F++ DQ           
Sbjct: 289 VDDAGKLMPGFITINNTLTED-PSVVVKGNERVLRARLSDARFFFEEDQ----------- 336

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLID-ADVALV 411
                       L+ R+  L   +VV+  K+GT  E++ R R L + +A L++ A  A  
Sbjct: 337 ---------KVKLETRVESLK--NVVYQQKLGTSYEKMERFRALAEGLADLLNPAVKAKT 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA  L KADL + +V EFPE+QG +G+EYA+LQ E+     AI EH  P     ++P +
Sbjct: 386 SRAAFLCKADLVSGMVGEFPEVQGIMGREYALLQGEDAEVAAAIAEHYLPTQAGGDLPAS 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS----- 526
            I   VS+ADKLDT+   + +   P+GS DPYALRR+ LGII IIL+    + L      
Sbjct: 446 DIGAFVSIADKLDTICGCFGVGLIPTGSADPYALRRSALGIINIILDRGCRLSLEGEIGK 505

Query: 527 ------------QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
                             +++ FF  R    + DR    D ++A +    D+L+     I
Sbjct: 506 ALELLSAKLTRPAAEVMADVLEFFRGRFVNLMADR-YPADAVDAAIAAGFDDLVDAEARI 564

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
             L  F      +   ++ KR+  I+         +   +        AE  L+A     
Sbjct: 565 GALAAFKGRPDFDSLAVAFKRVCNIVK------DGVDQPVDAALFQEPAEGALFAAFQQV 618

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
              ++       Y      + ++   ++ FFD+V+V  +D  VR NRL+LL  I  +   
Sbjct: 619 RADVEARTASGDYLAALTGIAALKGAVDDFFDKVMVMAEDERVRTNRLALLTGIARLFGG 678

Query: 695 VINVQKI 701
           V +  KI
Sbjct: 679 VADFAKI 685


>gi|146223|gb|AAA23915.1| glycyl-tRNA synthetase beta subunit [Escherichia coli]
          Length = 689

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/723 (28%), Positives = 338/723 (46%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
             FL+EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  L+ 
Sbjct: 4   KTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVANLAE 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
             P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L    
Sbjct: 64  AQPDREIEKRGPAIAQAFDAEGKPSKAPEGWARGCGITVDQAERL--TTDKGEWLLYRAH 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
                 E +L  +V  ++ K+P PK MRW       SA +++RP+ ++  +L      +K
Sbjct: 122 VKGESTEALLPNMVATSLAKLPIPKLMRWGA-----SAAAFVRPVHTVTLLL-----GDK 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAH 233
           +I   +  I    +  GHRF       + + D Y   L +   V+ D E R+  I  DA 
Sbjct: 172 VIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPEILRDGGKVIADYEERKAKIKADAE 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
             A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F   
Sbjct: 232 EAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
             +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+            
Sbjct: 292 ANDGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------ 338

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    K  +  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV    R
Sbjct: 339 --------KKRDEDNLPRLQT--VLFQQQLGTVRDKTDRIQALAGWIAEQIGADVNHATR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N +
Sbjct: 389 AGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           +  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E+  
Sbjct: 449 ACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAV 508

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                         ++I F   R + +  D     D I+A+L             +K ++
Sbjct: 509 RLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKAVS 568

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F +         + KR+  ILA   K +  +S  ++   L    E +L   +      +
Sbjct: 569 HFRTLDAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLRDKL 625

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           +      RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V ++
Sbjct: 626 EPYFTEGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRVADI 685

Query: 699 QKI 701
             +
Sbjct: 686 SLL 688


>gi|89092284|ref|ZP_01165238.1| glycyl-tRNA synthetase beta subunit [Oceanospirillum sp. MED92]
 gi|89083372|gb|EAR62590.1| glycyl-tRNA synthetase beta subunit [Oceanospirillum sp. MED92]
          Length = 682

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 199/715 (27%), Positives = 347/715 (48%), Gaps = 56/715 (7%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            DFL+E+ +EE+P +     ++  +  +   LKE GV + +++ Y +P RL + +  L  
Sbjct: 4   HDFLVELGTEELPPKALKTLSDAFTSGITAGLKEAGVNFGDVKSYASPRRLAVLISALDD 63

Query: 62  HSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIE 121
              ++  E+ GP V A +KA++GF RS G+      +I  D  KG+ Y     +  +   
Sbjct: 64  KQADREIEKRGPSVKAPEKAVEGFARSCGVTIDQLEKI--DTNKGEYYNFKNTEEGKATS 121

Query: 122 DVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLK 181
            +L  +V  ++ K+P PK MRW       S   ++RP+  ++ +       ++++D ++ 
Sbjct: 122 SLLPELVETSLNKLPIPKRMRWGA-----SRVEFVRPVHWLVMLF-----GDEVVDCEIL 171

Query: 182 EIPCGNITYGHRFHAPHPIKVQSLDHYIRDL-EEAMVLLDPECRRNAILNDAHRLASAVG 240
            +  G  T GHRFH    I++ +   Y   L    MV+ D + R+  I          + 
Sbjct: 172 GLTSGRKTRGHRFHYNQEIELIAPSEYADRLENPGMVIADYDIRKAMINEQVKAEGDKLN 231

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
                D+DLL+E+  L EW     G F++++L +P + +  ++K +QK F      G L 
Sbjct: 232 AVAQIDEDLLDEVTALNEWPVALTGRFEERFLEVPAQALISSMKEHQKYFHHLDANGNLL 291

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F  + NI + D    +++GN +V+  RL DA  F++ D+                   
Sbjct: 292 PNFTTICNIVSKD-PQQVIEGNEKVIRPRLSDAAFFFETDK------------------- 331

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+ R+ +L    +VF   +GT  ++ +RI  L  KIA  ++ D A  +RA +L K 
Sbjct: 332 -KTTLESRVEKLKT--IVFQKDLGTVYDKAARISALSGKIAATLNQDQAKAERAGLLCKT 388

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL T++V EF +LQG +G  YA+   E+     A  E   PR   + +P     + V++A
Sbjct: 389 DLLTDMVYEFTDLQGLMGYHYALNDGEDQDVALAQNEQYMPRFAGDELPQTAPGVAVAIA 448

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIIL----------------ENKIDIP 524
           D+LDTL   + IN+ P+GSKDP+ALRRA LG++RII+                 N  D+P
Sbjct: 449 DRLDTLTGLFGINQPPTGSKDPFALRRAALGVLRIIVERELDLDLRELLTIAANNHNDLP 508

Query: 525 LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSA 584
             + +E   ++ F  +R + +  D DI  ++  ++L  +    L     +K +N F S A
Sbjct: 509 AREGLE-DKVLDFMLERFRAWYEDADINAEVFLSVLALKPSRPLDFDRRVKAVNHFRSLA 567

Query: 585 KGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDH 644
           + E    + KR+  IL+   K+    + +++ + L   AEK L A I      +      
Sbjct: 568 EAEALAAANKRVSNILS---KQGVTGTTDVNNELLTEAAEKALAADIEAQKAALAPLFAE 624

Query: 645 KRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +Y +  + L  +    + FF+ V+V  +D  V++NRL+LL  ++ + L V ++ 
Sbjct: 625 GKYQEALESLAGLRASTDAFFEDVMVMAEDEAVKNNRLALLSQLRALFLGVADIS 679


>gi|254463281|ref|ZP_05076697.1| glycyl-tRNA synthetase, beta subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206679870|gb|EDZ44357.1| glycyl-tRNA synthetase, beta subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 685

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 283/710 (39%), Positives = 406/710 (57%), Gaps = 36/710 (5%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA+DL  ++   + E G+ Y +   + TP RL L ++GL 
Sbjct: 1   MPDLLIELFSEEIPARMQGRAADDLKKLMTDGMVEAGLTYASAAAFSTPRRLCLTVEGLL 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+VGA  KAI+GFLR  GL    D   ++D  KG VY A   K  R  
Sbjct: 61  AESPTVREERKGPKVGAPDKAIEGFLRGAGLT--RDKLEERDTSKGAVYFASFEKQGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL SILC+L  E +  +++ LD+
Sbjct: 119 PEIIAEVLEQTIRTFPWPKSMRWG-----TGSLRWVRPLHSILCVLSDEASS-EVVPLDV 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  TYGHRF AP+ I V   + Y   L+ A V+L+   R +AI  DA   A A G
Sbjct: 173 DGITSGKATYGHRFMAPNQITVNGFEDYEAQLKRAFVVLNAGERADAIWEDAKNQAFANG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VED  LL E+ GLVEW  V MG   + +L LP E+++ ++K +QK F  +  +    
Sbjct: 233 LEVVEDAGLLREVAGLVEWPVVLMGEIAEDFLGLPPEVLQTSMKEHQKFFSVKNAKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             FI V+N +  D GA I+ GN +V+ ARL DA  FW+ D     +  +   +A      
Sbjct: 293 ERFITVANRETVDNGATILAGNQKVLFARLSDAKFFWENDLRVATSDMASWTAA------ 346

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                        + +V FH K+GTQ ER+ RI  L +++A ++ AD    +RA  L+KA
Sbjct: 347 -------------LSNVTFHNKLGTQAERIERIAALARELAPVVGADADEAERAAKLAKA 393

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G+ YA    E  +   A EEH  P GP + VPT  +S+ VSLA
Sbjct: 394 DLSSEMVYEFPELQGLMGRYYAEAAGETAAVAAAAEEHYAPLGPSDAVPTAPVSVAVSLA 453

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI-------EDQN 533
           DK+DTL  FWAI+EKP+GSKDP+ALRRA LGIIR++LEN + I             +  +
Sbjct: 454 DKIDTLTGFWAIDEKPTGSKDPFALRRAALGIIRLVLENDLTIRSKPLFTKADMRADSDD 513

Query: 534 LILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLLS 592
           L+ FFHDRLK+YL D+ +RHD+I+A +    ND+L  +V     L  F  +  G   L  
Sbjct: 514 LLSFFHDRLKVYLRDQGVRHDVIDACIAMEGNDDLALLVKRAVALEAFLKTEDGTNLLQG 573

Query: 593 AKRIFQILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIG 651
            KR   IL+ EE K+  E S     ++   E E+ L+A ++  G  I+ ++  + +    
Sbjct: 574 FKRANNILSKEEDKDGVEYSYGGDVKFAETEEERALFAALTAEGPAIETALKAEDFAGAM 633

Query: 652 DLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             +  +  PI+ FF+ V VN D++ VR NRL+LL  I+ ++  V ++ ++
Sbjct: 634 SGMAGLRAPIDAFFEAVQVNSDNQTVRRNRLNLLSDIRKLVGSVADLSRV 683


>gi|308047728|ref|YP_003911294.1| glycyl-tRNA synthetase beta chain [Ferrimonas balearica DSM 9799]
 gi|307629918|gb|ADN74220.1| glycyl-tRNA synthetase beta chain [Ferrimonas balearica DSM 9799]
          Length = 697

 Score =  626 bits (1614), Expect = e-177,   Method: Composition-based stats.
 Identities = 204/729 (27%), Positives = 345/729 (47%), Gaps = 68/729 (9%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +  ++  L    + Y ++  + +P RL + +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRTLAESFAANMVDSLNAAELPYGDLTWFASPRRLAIKVSALAAQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +KI E+ GP V       G   KA +G+ RS G+      +I  D  KG+  L     
Sbjct: 65  QADKIVEKRGPAVQAAFDADGNPTKAAEGWARSNGITVAEAGRIATD--KGEWLLHKAEV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +   ++L  +V  A+ K+P PK MRW    +      +IRP++++  +L      E +
Sbjct: 123 KGQSAAELLPQMVSEALAKLPIPKPMRWGAYDT-----QFIRPVQTVTLML-----GEHL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           +   +     GN   GHRF     + ++  + Y   LEE   V+ D E R+  I+ D   
Sbjct: 173 LPATILGKASGNTLLGHRFMGEQVLTIEHAEQYPALLEEQGKVIADYERRKAKIVADIQA 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+ +G     D +LLEE+  LVEW  V   SF++K+L +P E +  T+K +QK F    
Sbjct: 233 AAAEIGGHADLDDELLEEVTSLVEWPVVLTASFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            EG L   FI VSN+++ D  A ++ GN +VV  RL DA  F++ D+             
Sbjct: 293 AEGKLLPKFIFVSNLESKD-PAVVIAGNEKVVRPRLADAEFFFETDK------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L + IA LI AD A   RA
Sbjct: 339 -------KQTLESLLPRLET--VLFQKQLGTLKDKTDRIQALAEHIAGLIGADRAHAARA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
             LSK DL T +V EF + QG +G  YA    E  +   A+ E  +PR   + +P++ ++
Sbjct: 390 GQLSKCDLMTNMVFEFTDTQGIMGMHYARHDGEAEAVAVALNEQYQPRFAGDELPSSGVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE---- 530
             +++ADK+D+L+  + I + P   KDP+ALRRA +GI+RI ++  + + L         
Sbjct: 450 QALAIADKMDSLVGIFGIGQPPKADKDPFALRRAAIGILRIAVDKALPLDLFDLAAFSYS 509

Query: 531 ------------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVD 572
                                ++ F   R + +  +     D+I+A+L       +    
Sbjct: 510 LFAEQEKLDADGKKGAEICNQVVDFMLGRFRAWYQEEGFPADVIQAVLAVRPTRPVDFDR 569

Query: 573 LIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVIS 632
            +K +  F S    E    + KR+  ILA   K    I+ ++    L  +AEK L  +++
Sbjct: 570 RVKAVQHFRSLDAAEALAAANKRVGNILA---KVEGPIADQVDAALLQDDAEKVLADIVA 626

Query: 633 DFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNII 692
                ++       Y      L  + EP++ FF+ V+VN +D  +R NR +LL+ ++ + 
Sbjct: 627 QVAAKVEPMFAAGDYQNALLALADLREPVDAFFEAVMVNAEDPALRANRQALLKQLRQLF 686

Query: 693 LIVINVQKI 701
           + V ++  +
Sbjct: 687 MQVADISLL 695


>gi|161505806|ref|YP_001572919.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189082271|sp|A9MLF8|SYGB_SALAR RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|160867153|gb|ABX23776.1| hypothetical protein SARI_03982 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 204/726 (28%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ +  +  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGKVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDNVIPATILGIQSDRVIRGHRFMGEPEFTIDTADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI+++D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESTD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|204928626|ref|ZP_03219825.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204322059|gb|EDZ07257.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGQPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|16766940|ref|NP_462555.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161616719|ref|YP_001590684.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167990886|ref|ZP_02571985.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168241824|ref|ZP_02666756.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168260601|ref|ZP_02682574.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194443562|ref|YP_002042901.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448924|ref|YP_002047683.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197264551|ref|ZP_03164625.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|25009333|sp|Q8ZL96|SYGB_SALTY RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|189082272|sp|A9MUU1|SYGB_SALPB RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238690224|sp|B4T945|SYGB_SALHS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238693534|sp|B4SWK1|SYGB_SALNS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|16422219|gb|AAL22514.1| glycine tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161366083|gb|ABX69851.1| hypothetical protein SPAB_04538 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402225|gb|ACF62447.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407228|gb|ACF67447.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197242806|gb|EDY25426.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205330783|gb|EDZ17547.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205339005|gb|EDZ25769.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205350246|gb|EDZ36877.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|261248804|emb|CBG26657.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995905|gb|ACY90790.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160191|emb|CBW19713.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914681|dbj|BAJ38655.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226709|gb|EFX51759.1| Glycyl-tRNA synthetase beta chain [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323132015|gb|ADX19445.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990505|gb|AEF09488.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|22127958|ref|NP_671381.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis KIM 10]
 gi|45443705|ref|NP_995244.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51598201|ref|YP_072392.1| glycyl-tRNA synthetase subunit beta [Yersinia pseudotuberculosis IP
           32953]
 gi|108809003|ref|YP_652919.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis Antiqua]
 gi|108813877|ref|YP_649644.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis Nepal516]
 gi|145597347|ref|YP_001161422.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis Pestoides F]
 gi|150260990|ref|ZP_01917718.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis CA88-4125]
 gi|153949017|ref|YP_001403073.1| glycyl-tRNA synthetase subunit beta [Yersinia pseudotuberculosis IP
           31758]
 gi|162420121|ref|YP_001608092.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis Angola]
 gi|165926203|ref|ZP_02222035.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936828|ref|ZP_02225394.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009645|ref|ZP_02230543.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213303|ref|ZP_02239338.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398625|ref|ZP_02304149.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420827|ref|ZP_02312580.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425595|ref|ZP_02317348.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467917|ref|ZP_02332621.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis FV-1]
 gi|170022285|ref|YP_001718790.1| glycyl-tRNA synthetase subunit beta [Yersinia pseudotuberculosis
           YPIII]
 gi|186897425|ref|YP_001874537.1| glycyl-tRNA synthetase subunit beta [Yersinia pseudotuberculosis
           PB1/+]
 gi|218931052|ref|YP_002348927.1| glycyl-tRNA synthetase subunit beta [Yersinia pestis CO92]
 gi|229839779|ref|ZP_04459938.1| glycine tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229841863|ref|ZP_04462019.1| glycine tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229896741|ref|ZP_04511905.1| glycine tRNA synthetase, beta subunit [Yersinia pestis Pestoides A]
 gi|229904400|ref|ZP_04519511.1| glycine tRNA synthetase, beta subunit [Yersinia pestis Nepal516]
 gi|270488339|ref|ZP_06205413.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis KIM D27]
 gi|294505601|ref|YP_003569663.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis Z176003]
 gi|25009332|sp|Q8Z9W7|SYGB_YERPE RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|81825680|sp|Q663V8|SYGB_YERPS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|122979893|sp|Q1CD86|SYGB_YERPN RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|123372145|sp|Q1C3J8|SYGB_YERPA RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166227933|sp|A4TGN7|SYGB_YERPP RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166980042|sp|A7FP95|SYGB_YERP3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238687308|sp|A9R4F9|SYGB_YERPG RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238688395|sp|B1JH07|SYGB_YERPY RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238691425|sp|B2K7F8|SYGB_YERPB RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|21961101|gb|AAM87632.1|AE014010_8 glycine tRNA synthetase, beta subunit [Yersinia pestis KIM 10]
 gi|45438575|gb|AAS64121.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51591483|emb|CAH23154.1| glycyl-tRNA synthetase beta subunit [Yersinia pseudotuberculosis IP
           32953]
 gi|108777525|gb|ABG20044.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis Nepal516]
 gi|108780916|gb|ABG14974.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis Antiqua]
 gi|115349663|emb|CAL22643.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis CO92]
 gi|145209043|gb|ABP38450.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis Pestoides F]
 gi|149290398|gb|EDM40475.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis CA88-4125]
 gi|152960512|gb|ABS47973.1| glycyl-tRNA synthetase, beta subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352936|gb|ABX86884.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis Angola]
 gi|165915070|gb|EDR33681.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922063|gb|EDR39240.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991567|gb|EDR43868.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205601|gb|EDR50081.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960956|gb|EDR56977.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051129|gb|EDR62537.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055609|gb|EDR65402.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169748819|gb|ACA66337.1| glycyl-tRNA synthetase, beta subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186700451|gb|ACC91080.1| glycyl-tRNA synthetase, beta subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678518|gb|EEO74623.1| glycine tRNA synthetase, beta subunit [Yersinia pestis Nepal516]
 gi|229691202|gb|EEO83255.1| glycine tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696145|gb|EEO86192.1| glycine tRNA synthetase, beta subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700280|gb|EEO88315.1| glycine tRNA synthetase, beta subunit [Yersinia pestis Pestoides A]
 gi|262363765|gb|ACY60486.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis D106004]
 gi|262367701|gb|ACY64258.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis D182038]
 gi|270336843|gb|EFA47620.1| glycyl-tRNA synthetase, beta subunit [Yersinia pestis KIM D27]
 gi|294356060|gb|ADE66401.1| glycyl-tRNA synthetase beta subunit [Yersinia pestis Z176003]
 gi|320017401|gb|ADW00973.1| glycine tRNA synthetase, beta subunit [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/722 (28%), Positives = 331/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL + +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDNANLSHGEVSWYAAPRRLAVKVANLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L  E     +
Sbjct: 123 KGQPAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGTE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + S D Y +  LE   V+ D E R++ I  DA +
Sbjct: 173 IPGTVLGINSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYELRKSIIKRDAEQ 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQQIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 TAGHLMPHFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLSLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        ++I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNAKVVDDVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDTLNDHVHASILKEPAELKLATHLVVLRDQLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FF+ V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYKEALVELAALRETVDEFFESVMVMAEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|300024367|ref|YP_003756978.1| glycyl-tRNA synthetase subunit beta [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526188|gb|ADJ24657.1| glycyl-tRNA synthetase, beta subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 693

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 286/711 (40%), Positives = 398/711 (55%), Gaps = 54/711 (7%)

Query: 13  IPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLG 72
           IPARMQ +A++DL  +++  LK  G+     R + TP RL L ++G+   SP   EE+ G
Sbjct: 13  IPARMQARASDDLKRLIVDGLKARGLDVGEARSFATPRRLTLVIEGVPAKSPAISEEKKG 72

Query: 73  PRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAI 132
           PRVGA  +A+ GFL+S GL ++ D  + KD KKGD Y+A + KP R   +++   +    
Sbjct: 73  PRVGAPDQAVQGFLKSAGLASLEDATVVKDEKKGDFYVAKIEKPGRAAAEIIAETIVEVA 132

Query: 133 QKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGH 192
            K PWPKSMRW +     S+F W+RPL+S+LC+L       K++  +L  I  GN T GH
Sbjct: 133 AKFPWPKSMRWGS-----SSFQWVRPLQSVLCLL-----DGKVVPFELNGIEAGNETRGH 182

Query: 193 RFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEE 252
           RF  P P KV++   Y   L    V+LDP  R  AI   AH LA    LEL+ED  LL E
Sbjct: 183 RFLGPGPFKVKNFADYEAKLAAHHVMLDPAKRAAAISEQAHALAKDAKLELIEDDALLAE 242

Query: 253 IIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT-REGVLANCFILVSNIQA 311
             GL EW  V MG+FDK +L +P E++  ++KT+QKCF  R  R   LAN F+LVSN+ A
Sbjct: 243 NAGLTEWPVVLMGTFDKAFLEVPAEVLTTSMKTHQKCFSLRETRSKKLANKFLLVSNLVA 302

Query: 312 SDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMAR 371
            DGGA IV GN +V+ ARL DA  FW++D                    L  PL +   +
Sbjct: 303 KDGGAEIVSGNEKVIRARLSDAKFFWEQD--------------------LKHPLGEMAGK 342

Query: 372 LDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFP 431
           L    + FH K+G+Q +RV RI  L  ++A   DA      RA  L+KADL + +V EFP
Sbjct: 343 LS--GITFHEKLGSQKDRVERIEALAFELAGACDAIPEDARRAAGLAKADLVSGMVGEFP 400

Query: 432 ELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS----ITVSLADKLDTLI 487
           ELQG +G+ YA           A+E H KP+GP + VP         + V+LADKLDTL+
Sbjct: 401 ELQGLMGRYYAEHVGTKPEIARALELHYKPKGPTDTVPREDQGDAVAVAVALADKLDTLV 460

Query: 488 NFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE---------------DQ 532
            FWAI EKP+GS DPY LRRA LG+IRI+LEN + +PL+ +IE                 
Sbjct: 461 GFWAIGEKPTGSGDPYQLRRAALGVIRIVLENDLRVPLNHYIEIGERLHGAKKAAGEVQS 520

Query: 533 NLILFFHDRLKLYLHDRDIRHDLIEAILRP-ENDNLLTIVDLIKHLNEFFSSAKGEKFLL 591
           +L+ FF DRLK++L D+  RHDLI+A+      D+L  IV  ++ L+ F  +  G   L 
Sbjct: 521 DLLSFFADRLKVFLRDQGKRHDLIDAVFALGGQDDLALIVRRVEALDAFLKTDDGANLLA 580

Query: 592 SAKRIFQILAIEEKKNRE-ISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQI 650
             KR   ILAIEEKK+++  +     + +  + E  L A I         +++ + +   
Sbjct: 581 GVKRAANILAIEEKKDKKSYAGPYDLKLITEKEETALAAAIEATKQDTVAAINVENFAGA 640

Query: 651 GDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
              L  +  P++ FF+++LVN DD ++R+NRL LL  I+     V +  KI
Sbjct: 641 MRALSELRAPVDAFFEKILVNADDPKIRENRLRLLSEIRAATQTVADFSKI 691


>gi|200388817|ref|ZP_03215429.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199605915|gb|EDZ04460.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + S D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDSADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|238910311|ref|ZP_04654148.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 689

 Score =  625 bits (1613), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 339/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  ++     L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAVNFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYDDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|89074697|ref|ZP_01161155.1| glycyl-tRNA synthetase beta subunit [Photobacterium sp. SKA34]
 gi|89049461|gb|EAR55022.1| glycyl-tRNA synthetase beta subunit [Photobacterium sp. SKA34]
          Length = 689

 Score =  625 bits (1612), Expect = e-177,   Method: Composition-based stats.
 Identities = 215/723 (29%), Positives = 342/723 (47%), Gaps = 62/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            +FL+E+ +E++P       AE  +      LK   + +  ++ Y  P RL L + GL+ 
Sbjct: 4   KNFLIELGTEDLPPTALRTLAEAFATNFEAELKAADLPHDGIKWYAAPRRLALKVTGLAE 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
           + P+K+ E+ GP V       G   KA  G+ R  G+      ++  D  KG+  L    
Sbjct: 64  NQPDKVVEKRGPAVSAAFDADGNPTKAAQGWARGNGITVDQAERMVTD--KGEWLLFKQE 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
              +  + +L  +   A+ K+P P+ MRW    +      +IRP+K++  +L      ++
Sbjct: 122 VKGQPAQALLPELAAAALAKLPIPRPMRWGDKET-----QFIRPVKTLTMLL-----GDE 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAH 233
           +I+  +  +       GHRF       + + D Y   LE    V+ D + R+  IL DA 
Sbjct: 172 LIEGTILGVASARTIRGHRFMGEAEFTIDNADQYPAILEERGKVMADYDARKAIILADAK 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
           + A AVG     + DL+EE+  LVEW  V   SF++++L +P E +  T+K +QK F   
Sbjct: 232 KAAEAVGGIADLEDDLVEEVTSLVEWPVVLTASFEEEFLKVPSEALVYTMKGDQKYFPVY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
             EG L   FI VSNI ++D  + I+ GN +VV  RL DA  F+  D             
Sbjct: 292 DAEGKLVPKFIFVSNIISND-PSQIISGNEKVVRPRLADAEFFFNTD------------- 337

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                  L   L  R+ +L+    +F  ++GT  ++  RI  L   IA  I ADV    R
Sbjct: 338 -------LKSKLVDRLPQLETA--IFQKQLGTIKDKTDRITELAGYIADKIGADVDNAKR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +L+K DL T +V EF + QG +G  YA    E      A+ E   PR   + +P+  +
Sbjct: 389 AGLLAKCDLMTSMVFEFTDTQGVMGMHYARHDGEQEDVALALNEQYMPRFAGDQLPSTPV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--- 530
           S  V++ADKLDT++  + I + P GS DP+ALRRA+LG++RII+EN  D+ L   I    
Sbjct: 449 SSAVAMADKLDTIVGIFGIGQAPKGS-DPFALRRASLGVLRIIVENGYDLDLVDLIAKAH 507

Query: 531 ------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                       D ++I F   R + +  D     D+I+A+L             +K ++
Sbjct: 508 SLFGDKLTNDNVDSDVIEFMLGRFRAWYQDAGFSIDVIQAVLAMHPTQPADFDKRVKAVS 567

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F      E    + KR+  ILA   K + E+   +    L+  AEK L   ++     +
Sbjct: 568 HFRELDAAESLAAANKRVGNILA---KFDGELPTTVDNSLLVEAAEKELAEKVTAVVAAL 624

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           +       Y      L S+ EP++ FFD V+V  DD +++ NRL+LL  ++N  L V ++
Sbjct: 625 ESVFAAGDYQTALSELASLREPVDAFFDNVMVMADDEKLKVNRLALLSLLRNQFLKVADI 684

Query: 699 QKI 701
             +
Sbjct: 685 SLL 687


>gi|322613960|gb|EFY10896.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620329|gb|EFY17197.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625334|gb|EFY22161.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629999|gb|EFY26772.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634189|gb|EFY30924.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635910|gb|EFY32619.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643062|gb|EFY39637.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644607|gb|EFY41143.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650849|gb|EFY47241.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652987|gb|EFY49322.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659950|gb|EFY56190.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663283|gb|EFY59487.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668769|gb|EFY64922.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674428|gb|EFY70521.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678364|gb|EFY74425.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680870|gb|EFY76904.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687194|gb|EFY83167.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192153|gb|EFZ77386.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200657|gb|EFZ85731.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201367|gb|EFZ86433.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206767|gb|EFZ91721.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211803|gb|EFZ96635.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216162|gb|EGA00890.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220385|gb|EGA04839.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226242|gb|EGA10457.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228362|gb|EGA12493.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234183|gb|EGA18271.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237168|gb|EGA21235.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244687|gb|EGA28691.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249168|gb|EGA33086.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250713|gb|EGA34593.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257588|gb|EGA41275.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262297|gb|EGA45858.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266148|gb|EGA49639.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268783|gb|EGA52241.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 689

 Score =  625 bits (1612), Expect = e-177,   Method: Composition-based stats.
 Identities = 207/726 (28%), Positives = 337/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    I  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRIIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|146309830|ref|YP_001174904.1| glycyl-tRNA synthetase subunit beta [Enterobacter sp. 638]
 gi|166980039|sp|A4W573|SYGB_ENT38 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|145316706|gb|ABP58853.1| glycyl-tRNA synthetase beta chain [Enterobacter sp. 638]
          Length = 689

 Score =  625 bits (1612), Expect = e-177,   Method: Composition-based stats.
 Identities = 204/726 (28%), Positives = 335/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  +   L   G+ +  +  +  P RL L +  
Sbjct: 1   MSDKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLTHGKIEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+    ++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LAASQADREVEKRGPAISQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E +L  ++  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESAEALLPNMIATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            + +I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDTVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYELRKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYANDGKLLPNFIFVANIESKDPIQ-IISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI  L   IA+ I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIAELSGWIAREIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  V++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLSLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 +I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNAKVVDEVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +         + KR+  ILA   K +  ++  ++   L    E  L   +    
Sbjct: 566 AVSHFRTLEAASALAAANKRVSNILA---KSDETLNERVNAATLKEPEEIALALQVVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             ++      RY +    L  + E I+ FF++V+VNV+D+++R NRLS+L+ ++ + L V
Sbjct: 623 DKLEPFFAEGRYQEALVELAELREVIDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|62182160|ref|YP_218577.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|81309553|sp|Q57IG6|SYGB_SALCH RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|62129793|gb|AAX67496.1| glycine tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|322716647|gb|EFZ08218.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 689

 Score =  625 bits (1612), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLEHGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN  ++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAKEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|332288855|ref|YP_004419707.1| glycyl-tRNA synthetase subunit beta [Gallibacterium anatis UMN179]
 gi|330431751|gb|AEC16810.1| glycyl-tRNA synthetase subunit beta [Gallibacterium anatis UMN179]
          Length = 689

 Score =  625 bits (1612), Expect = e-177,   Method: Composition-based stats.
 Identities = 203/723 (28%), Positives = 344/723 (47%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            +FL EI +EE+P +   K A      +   L + G+ +  +  + +P RL + + GL+ 
Sbjct: 4   KNFLAEIGTEELPPKALKKLAVAFKDNVEQELTQAGLAFDAVEWFASPRRLAVKVLGLAE 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
             P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +    
Sbjct: 64  AQPSKEVEKRGPAVAAAFDAEGKPTKAAEGWARGCGISVDQAERLVTD--KGEWLVHRAV 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
              +  +++L  I+  A+ K+P PK MRW   +       +IRP+ ++  +       ++
Sbjct: 122 IEGQPTKNLLLGIISNALAKLPIPKPMRWGDKNE-----QFIRPVHTVTLLF-----GDE 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAH 233
           +I+  +  +  G    GHRF       + + D Y + L E   V+ D E R+  I  DA 
Sbjct: 172 LIEGKILGVKSGRTIRGHRFLGQQEFTIDNADQYPQLLAEKGSVIADFEQRKAIIRQDAE 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
           + A+ VG     ++DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F   
Sbjct: 232 KAAAKVGGIADIEEDLLDEVTSLVEFPVVMTAKFEERFLAVPAEALVYTMKGDQKYFPIY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
            + G L   FI VSNI   D  +  ++GN +VV  RL DA  F+K D             
Sbjct: 292 DQNGKLLPNFIFVSNINPQDQSSV-IEGNEKVVRPRLSDAEFFFKTD------------- 337

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                  L + L+  + RL    V+F  ++GT  ++  RI  L  +IA  I ADVA  +R
Sbjct: 338 -------LKQRLEDNLPRLKT--VLFQQQLGTLFDKTERIEKLSGEIAAQIGADVAKAER 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + +
Sbjct: 389 AGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPHSLV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           + +V+LADK DTL+  + I + P G KDP+ALRRA LG++RII+E K+ + L    +   
Sbjct: 449 ACSVALADKFDTLVGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLVDLAQKAA 508

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                        ++++ F   R + +  +  I  D+I+A+L             +K +N
Sbjct: 509 ALYGDKLSNANVVEDVVDFILGRFRAWYQEEGIAVDVIQAVLACRPTKPADFDARVKAVN 568

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F +    +    + KR+  IL+   K +  +   I         E  L   + +    +
Sbjct: 569 HFRTLDAAQALAAANKRVQNILS---KVDGALPENIDLSLCREPQEINLAERVLELQREL 625

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           Q   +   Y  +   L  + E ++ FFD V+VN +D ++R NRL+LL+ ++++   + ++
Sbjct: 626 QPLFEKGDYQTVLSRLADLRESVDSFFDNVMVNAEDEKLRQNRLALLKNLRDLFFKIADI 685

Query: 699 QKI 701
             +
Sbjct: 686 SLL 688


>gi|295689050|ref|YP_003592743.1| glycyl-tRNA synthetase subunit beta [Caulobacter segnis ATCC 21756]
 gi|295430953|gb|ADG10125.1| glycyl-tRNA synthetase, beta subunit [Caulobacter segnis ATCC
           21756]
          Length = 664

 Score =  625 bits (1611), Expect = e-177,   Method: Composition-based stats.
 Identities = 275/703 (39%), Positives = 392/703 (55%), Gaps = 43/703 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP  LLE++SEEIPARMQ +AA+DL  +    L   G + + +  +  P RL L  +GL 
Sbjct: 1   MPQLLLELFSEEIPARMQAQAAKDLERMAREHLAAAGFLPEALTTFAGPRRLTLVAEGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               ++ EE  GPRVGA  +A++GFLR TGL    D  +++D     VY+A + K  R  
Sbjct: 61  LAQADRKEELKGPRVGAPPQAMEGFLRKTGLT--QDQLVERDG----VYMAFIEKKGRPT 114

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  +V   ++  PWPKSM W           W+RPLK ILC+L  E     ++   +
Sbjct: 115 AEIVAEMVEAIVRGFPWPKSMIWG-----YKKLRWVRPLKRILCVLDRE-----VVPFSI 164

Query: 181 KEIPCGNITYGHRFHAP-HPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAV 239
           + I  G++T GHRF     P   +  D Y   LE+  V+LD E R+  IL     L  A 
Sbjct: 165 EGIESGDVTEGHRFMGEAKPFVAKDFDEYAAGLEKHFVVLDVEERKQRILEGCKTLCFAR 224

Query: 240 GLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR-EGV 298
            LELVED+ LL+E+ GL EW    +G  D  +L LP E+IR +++T+QK F  +   E  
Sbjct: 225 HLELVEDQGLLDEVAGLAEWPTPVLGDMDPSFLDLPPEVIRTSMRTHQKYFAVKKPGEPG 284

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           LA  FI ++NIQA DGGA I  GN++V++ARL DA  FW  D+                 
Sbjct: 285 LAPHFITIANIQAKDGGAVIAAGNAKVLSARLSDARFFWDEDR----------------- 327

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
                  +  + +L+   V FHAK+GT  +RV RI  L   IA L+ ADVA    A  L+
Sbjct: 328 ---KAGFEPWLEKLN--GVTFHAKLGTMAQRVERIVALAGAIAPLVGADVAKAKEAARLA 382

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           KADL + +V EFPELQG +G  YA     +     AI++H KP+GP + VPT+ ++I V+
Sbjct: 383 KADLASGMVGEFPELQGLMGGYYAREAGLDPEIAAAIQDHYKPQGPSDAVPTSPLAIAVA 442

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFF 538
           LADKLDTL+ F+AI+EKP+GSKDPYALRRA LG+IRI+LEN + + L++F +  +LI FF
Sbjct: 443 LADKLDTLVGFFAIDEKPTGSKDPYALRRAALGVIRIVLENGLRVSLAKFGK-DDLIAFF 501

Query: 539 HDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQ 598
            DRLK+ L D+  RHDL++A+    +D+L  IV  ++ L+ F  +  G+  L   KR   
Sbjct: 502 ADRLKVTLRDQGKRHDLVDAVFALGDDDLARIVARVEALDGFLKTDDGKNLLAGYKRASN 561

Query: 599 ILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSIC 658
           IL  EEKK    S E         AE +LY  +      + +++  + +      L  + 
Sbjct: 562 ILKAEEKKGALPSGEPEAPAADSAAEVQLYDALRVLKGPLADALAKEDFTGAMAQLAGLR 621

Query: 659 EPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
            P++ + D V VN  D E RDNRL  L  +++ +  V +   I
Sbjct: 622 GPVDAYLDGVFVN--DPEHRDNRLKTLAAVRDAMGQVADFGLI 662


>gi|56415548|ref|YP_152623.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364476|ref|YP_002144113.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|81821567|sp|Q5PLN2|SYGB_SALPA RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|238690750|sp|B5BHU1|SYGB_SALPK RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|56129805|gb|AAV79311.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095953|emb|CAR61536.1| glycine-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 689

 Score =  625 bits (1611), Expect = e-177,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVVTSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + S + Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDSAEQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|312115351|ref|YP_004012947.1| glycyl-tRNA synthetase subunit beta [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220480|gb|ADP71848.1| glycyl-tRNA synthetase, beta subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 721

 Score =  625 bits (1611), Expect = e-176,   Method: Composition-based stats.
 Identities = 301/752 (40%), Positives = 419/752 (55%), Gaps = 84/752 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MP+ LLE++SEEIPAR+Q + A+DL+ ++   L + G+     R    P R+      + 
Sbjct: 1   MPNLLLELFSEEIPARLQGRGADDLAKLMTEALTKGGLTVGATRTLSGPRRIVFIADDVP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
            HS   +EER GPR  A  KA++GF+++ GL +I + Q+ KDP KGD YLA   KP R  
Sbjct: 61  AHSAATVEERKGPRTSAPAKALEGFVKAAGLNSIDEAQVVKDP-KGDYYLARSEKPGRAA 119

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D++   VP  I+K PWPKSMRW           WIRPL SILC+       +K +  ++
Sbjct: 120 ADIIAEAVPDIIRKFPWPKSMRWGNGR-----LRWIRPLHSILCLF-----DDKPVAFEV 169

Query: 181 KEIPCGNITYGHRFHA------PHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHR 234
             I  G+ITYGHRF +      P  +KV  +  Y   L  A V++  E R  AIL  AH 
Sbjct: 170 DGIKSGDITYGHRFLSGENITQPKVVKVDRISDYADALMHAKVVVAGEHRAKAILEGAHT 229

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            AS  GL LVED  LL E  GLVEW  V  G F++ +L +PEE++  ++K +QKCF  R+
Sbjct: 230 AASDAGLALVEDHGLLAENAGLVEWPVVLSGQFEESFLDVPEEILMTSMKAHQKCFSLRS 289

Query: 295 -REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
            + G LAN FILVSN++A DGG AIV GN RV+ ARL DA  FW+ D+            
Sbjct: 290 AKTGKLANRFILVSNLEAEDGGKAIVAGNERVIRARLSDAKFFWENDR------------ 337

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    +PL+   A L    V FH K+GTQ  RV RI+ L +++A ++ AD     R
Sbjct: 338 --------KRPLEGLTALLGQ--VTFHEKLGTQFRRVERIKALARELAPIVGADPDDAVR 387

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A  L+KADL +E V EFPELQG IG   A+ Q E  +  DAI EH KP+GP + VPTN +
Sbjct: 388 AAHLAKADLMSETVGEFPELQGIIGSYIALAQGEKPAVADAIAEHYKPQGPSDAVPTNPV 447

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE--- 530
           ++ V+LADKLD L+ FWAI+EKP+GSKDP+ALRRA LG+IRI+LEN + + L + IE   
Sbjct: 448 AVAVALADKLDMLVGFWAIDEKPTGSKDPFALRRAALGVIRIVLENGLRVELMKIIEKAS 507

Query: 531 ---------------------------------------DQNLILFFHDRLKLYLHDRDI 551
                                                  +  ++ FF DRLK+YL D+  
Sbjct: 508 ELIDEDQYERAMRRVEKSGGTVAFAKTSVEWNGRQIGTREAEMLSFFADRLKVYLRDQGA 567

Query: 552 RHDLIEAILR-PENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKN-RE 609
           RHDLI+A+   P  D+LL +V  ++ L  F  +  G+  L   +R   IL IEEKK+ R 
Sbjct: 568 RHDLIDAVFALPGQDDLLMVVRRVEALGRFLETDDGKSLLALVRRALNILRIEEKKDARA 627

Query: 610 ISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVL 669
              E + + L  + EK L + +   G  ++ ++  + +      L  +  P++ FFD+V 
Sbjct: 628 FDGEPAAKLLKEKEEKALASAVKAVGKDVRAALATEDFEAAMTALAKLRAPVDAFFDKVT 687

Query: 670 VNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           VN D  ++R+NRL+LL  I+ + L + +  KI
Sbjct: 688 VNADAADIRENRLTLLAQIRALTLDIADFSKI 719


>gi|109896340|ref|YP_659595.1| glycine--tRNA ligase [Pseudoalteromonas atlantica T6c]
 gi|123361467|sp|Q15ZZ0|SYGB_PSEA6 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|109698621|gb|ABG38541.1| glycyl-tRNA synthetase beta chain [Pseudoalteromonas atlantica T6c]
          Length = 692

 Score =  625 bits (1611), Expect = e-176,   Method: Composition-based stats.
 Identities = 205/720 (28%), Positives = 348/720 (48%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           + L+EI +EE+P +   K A+  +  L G L    + Y +++ + +P RL + + GL+  
Sbjct: 5   NLLVEIGTEELPPKALGKLAQAFADNLQGALDTAELKYTSIKWFASPRRLAVNVIGLAEQ 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +K+ E+ GP V       G   KA  G+ RS G+      ++     KG+  L     
Sbjct: 65  QEDKLIEKKGPAVSVAFDESGQATKAAQGWARSNGITVEQAERL--TTDKGEWLLFKGEA 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
               +  +L  ++  A++K+P PK+MRW +     S+  +IRP+ ++  +  A+     +
Sbjct: 123 KGEQVSSLLPAMIDGALKKLPIPKAMRWGS-----SSIQFIRPVHTVTMLFGAD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRL 235
           I+ ++  I    +  GHRFH      +   D Y+  LE   VL D   R++ I +  +  
Sbjct: 173 IEGNILGIDSDRVINGHRFHGEKQFSLSHADDYLAQLEAHYVLADFSARKDKIRHQVNAA 232

Query: 236 ASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR 295
           A         ++DLL+E+  LVEW      SFD  +L +P+E +  T+K +QK F    +
Sbjct: 233 AQKEDAVADMNEDLLDEVTALVEWPVALTASFDDSFLEVPKEALIYTMKDDQKYFPLIDQ 292

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
            G L + F+ V+NI++ D    I+ GN +V+  RL DA  F+  D+              
Sbjct: 293 NGQLKSRFVFVTNIESKD-PMQIISGNEKVIRPRLADAEFFFNTDK-------------- 337

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAI 415
                    L+ R+  L    V+F  ++GT  E+  RI  L   IA ++ +D++   RA 
Sbjct: 338 ------KTTLESRLESLKT--VLFQKQLGTLYEKSQRISELAGTIANMLSSDISQASRAG 389

Query: 416 VLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISI 475
           +LSK DL T +V EFP++QG +G  YA    E+     A+ E   PR   + +PT+ IS 
Sbjct: 390 LLSKTDLMTNMVMEFPDVQGVMGMHYAKHDGEHDKVALALNEQYMPRFAGDQLPTSNISC 449

Query: 476 TVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE----- 530
            V++ADK+DTL+  + I + P G KDP+ALRRA +G++RI +E K+ + L+  ++     
Sbjct: 450 AVAIADKIDTLVGIFGIGQVPKGDKDPFALRRAAIGVLRISVEMKLPLDLTTLVQASINS 509

Query: 531 -----------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                      +  +I F   R + +  D+ I  D+I+A+              I+ ++ 
Sbjct: 510 FGTKLTHVEDLESQVIDFILGRFRAWYQDQHIDIDVIQAVAARRPTKPADFAARIEAVSA 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S A G     + KR+  ILA   K     +  I+      E E  L   +SD    + 
Sbjct: 570 FKSLASGLALASANKRVANILA---KNKVTDTNSINSSLFESEHEAALADAMSDIEETVN 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
             +    Y  +   L ++ + ++ FFD V+V  +D  VR+NRL+LL  ++ + L+V ++ 
Sbjct: 627 AFVVDANYQGVFTELATLHDKVDAFFDNVMVMAEDENVRNNRLALLSKLRTLFLLVADIS 686


>gi|270264147|ref|ZP_06192414.1| glycyl-tRNA synthetase, beta subunit [Serratia odorifera 4Rx13]
 gi|270041796|gb|EFA14893.1| glycyl-tRNA synthetase, beta subunit [Serratia odorifera 4Rx13]
          Length = 689

 Score =  625 bits (1611), Expect = e-176,   Method: Composition-based stats.
 Identities = 202/720 (28%), Positives = 326/720 (45%), Gaps = 61/720 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDSANLEHGEVSWFAAPRRLALKVANLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW       S   ++RP+ ++  +L AE     +
Sbjct: 123 KGQSAQALLAGMVSTALSKLPIPKLMRWGD-----SEVQFVRPVHTVTLLLGAE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I       GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIESARTLRGHRFMGEAEFTIDNADQYPQILLERGKVIADYEARKALIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G +    + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQQIGGKADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 AAGKLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAGQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPESLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
            ++++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CSLAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         ++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGSKLSNAKAVDEVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLEEAAALAAANKRVSNILA---KSTDTLNDRVHAAVLKEAAEIQLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y      L ++ EP++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGDYQDALVQLAALREPVDAFFDNVMVMAEDDAVRVNRLTLLSKLRELFLQVADIS 686


>gi|77163904|ref|YP_342429.1| glycine--tRNA ligase [Nitrosococcus oceani ATCC 19707]
 gi|254435742|ref|ZP_05049249.1| glycyl-tRNA synthetase, beta subunit [Nitrosococcus oceani AFC27]
 gi|76882218|gb|ABA56899.1| glycyl-tRNA synthetase beta chain [Nitrosococcus oceani ATCC 19707]
 gi|207088853|gb|EDZ66125.1| glycyl-tRNA synthetase, beta subunit [Nitrosococcus oceani AFC27]
          Length = 691

 Score =  625 bits (1611), Expect = e-176,   Method: Composition-based stats.
 Identities = 222/727 (30%), Positives = 348/727 (47%), Gaps = 64/727 (8%)

Query: 1   MP---DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLK 57
           M    D L+EI +EE+P +   K +E L   L   L+  G+IY +++ Y  P RL ++++
Sbjct: 1   MAETRDLLIEIGTEELPPKALRKLSESLLQELSHGLQAAGLIYGDLKGYGAPRRLAVWVQ 60

Query: 58  GLSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYL 110
            L+   PE++ ER GP +       G    A  GF  S G+   +   +K +  KG   +
Sbjct: 61  ALTVSQPEQVLERRGPALAAAFNEEGKPTAAARGFAGSCGVPVEALESLKNE--KGAWLV 118

Query: 111 AVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAED 170
              R+      ++L  I+  A+Q +P PK MRWS          +IRP+  ++ +     
Sbjct: 119 YRQRQQGAPTRELLPAILAQALQALPIPKPMRWSDL-----PGEFIRPVHWLVLLF---- 169

Query: 171 AKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAIL 229
             E++I   L  +  G  T GHRFH P P+ +     Y   LE E  VL D   RR AI 
Sbjct: 170 -GEEVIPATLLGVQAGRETQGHRFHHPEPLYLTEPAAYATLLETEGKVLADFAVRREAIY 228

Query: 230 NDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKC 289
                 A  +G + + ++ LL+E+ GLVEW     G FD  +L LP E++  T++ +QK 
Sbjct: 229 TQVVAAAQQMGGKALIEEALLDEVTGLVEWPVALAGQFDGDFLKLPAEVLIATMQDHQKY 288

Query: 290 FVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSS 349
           F  +  +G L  CFI V NI++      +V+GN RV+  RL DA  F+  D+        
Sbjct: 289 FPVQDEQGHLLPCFITVCNIES-QRPEVVVEGNERVIRPRLTDAAFFYATDR-------- 339

Query: 350 LKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVA 409
                        + L  R  RL    + F  K+G+  ER  R+  L   IA+ I  +  
Sbjct: 340 ------------KESLASRCERLK--KITFQEKLGSVFERTERLAKLAWHIAKDIGGNGD 385

Query: 410 LVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
              RA +LSK DL TE+V EFPELQG +G+ YA+  +E     +A+ E   PR   + +P
Sbjct: 386 WAKRAGLLSKCDLVTEMVTEFPELQGSMGRYYALHDHEPQEVAEALREQYLPRFAGDVLP 445

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
                  +SLAD+LDTL+  + I   PSG KDPY LRRA LG++RII+E+ + + L   +
Sbjct: 446 RTATGQALSLADRLDTLVGLFGIGAPPSGDKDPYGLRRAALGVLRIIIESGLALDLPSLL 505

Query: 530 EDQ---------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
           +                  +  +  +RL+ Y  +   R D IEA+L    D  L     +
Sbjct: 506 KRACETYNDRLTEKNTAVQVHAYLLERLRGYYLEAGFRPDEIEAVLAVRPDQPLDFDRRL 565

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
           K +  F    + E    + KRI  IL    K   ++  +I    L   AE+ L   +   
Sbjct: 566 KAVASFRKLPEAESLSAANKRIRNILR---KSGEKLPAQIESDLLQDPAEQTLATQMYSL 622

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
              +   ++ + +      L  +   ++ FFD+V+V V+D ++R NRL+LL  ++ + L 
Sbjct: 623 EREMMPLLERQDHRATLTALAGLRGAVDQFFDEVMVMVEDPKLRANRLALLARLQTLFLQ 682

Query: 695 VINVQKI 701
           V ++ ++
Sbjct: 683 VADISRL 689


>gi|238793179|ref|ZP_04636807.1| Glycyl-tRNA synthetase beta subunit [Yersinia intermedia ATCC
           29909]
 gi|238727552|gb|EEQ19078.1| Glycyl-tRNA synthetase beta subunit [Yersinia intermedia ATCC
           29909]
          Length = 689

 Score =  624 bits (1610), Expect = e-176,   Method: Composition-based stats.
 Identities = 204/722 (28%), Positives = 329/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL + +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDNANLPHGEVVWYAAPRRLAVKVTDLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + S D Y +  LE   V+ D E R++ I  DA  
Sbjct: 173 IPGTVLGIDSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYELRKSIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGIADLSESLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGSLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNGNVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAATLAAANKRVSNILA---KSTDTLNDHVHASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y +    L ++ E ++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGNYQEALVELAALRETVDEFFDSVMVMAEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|197251342|ref|YP_002148583.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|238689993|sp|B5EX65|SYGB_SALA4 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|197215045|gb|ACH52442.1| glycyl-tRNA synthetase, beta subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 689

 Score =  624 bits (1610), Expect = e-176,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 338/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPAIILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAARLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN +++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAEEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|188535522|ref|YP_001909319.1| glycyl-tRNA synthetase subunit beta [Erwinia tasmaniensis Et1/99]
 gi|238689720|sp|B2VCH1|SYGB_ERWT9 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|188030564|emb|CAO98459.1| Glycyl-tRNA synthetase beta chain [Erwinia tasmaniensis Et1/99]
          Length = 689

 Score =  624 bits (1610), Expect = e-176,   Method: Composition-based stats.
 Identities = 202/726 (27%), Positives = 335/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +  L   L   G+ +  +  +  P RL L +  
Sbjct: 1   MTDKTFLVEIGTEELPPKALRSLAESFAANLTAELDAAGLAHGEVSWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  + 
Sbjct: 61  LSAAQPDREVEKRGPAIQAAFDANGVATKAAEGWARGCGITVDQAERL--STDKGEWLMY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
             R      + +L  ++  ++ K+P PK MRW       S   ++RP+ ++  +L     
Sbjct: 119 RARVTGERTQVLLPAMIATSLAKLPIPKLMRWGA-----SEVQFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +++I  ++  I    I  GHRF       +   D Y +  LE   V  D   R+  I  
Sbjct: 169 GDELIPANILGIDSARIIRGHRFMGEPEFTIDHADQYPQILLERGKVQADYAARKAIIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A+ +G        LLEE+  LVEW  V   +F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEAAAAKIGGVADLSDSLLEEVTSLVEWPVVLTATFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
               + G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDKAGKLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNSDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       + L+  + RL+   V+F  ++GT   +  RI+ L   +A  I ADV  
Sbjct: 339 -----------KRRLEDNLPRLET--VLFQKELGTLRAKTDRIQALAGWVAAQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                 ++ F   R + +  +     D ++A+L             +K
Sbjct: 506 EAVRLYGSKLSNAKAVDEVVDFMLGRFRTWYQEEGHSVDTLQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L    E +L   ++   
Sbjct: 566 AVSHFRTLEQAASLAAANKRVSNILA---KATEPLNDSVQASLLKENEEIKLATYVTALS 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +Q      RY      L  + E ++ FFD+V+VN +++EVR NRL+LL  ++ + L V
Sbjct: 623 SKLQPFFAEGRYQDALIELAQLREAVDNFFDKVMVNAEEKEVRINRLTLLAKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|224585454|ref|YP_002639253.1| glycyl-tRNA synthetase subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|254781860|sp|C0Q1B6|SYGB_SALPC RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|224469982|gb|ACN47812.1| glycyl-tRNA synthetase beta subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 689

 Score =  624 bits (1610), Expect = e-176,   Method: Composition-based stats.
 Identities = 206/726 (28%), Positives = 336/726 (46%), Gaps = 63/726 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +  FL+EI +EE+P +     AE  +      L   G+ + N+  +  P RL L +  
Sbjct: 1   MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGNVEWFAAPRRLALKVAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++  E+ GP +       G   KA +G+ R  G+      ++K D  KG+  L 
Sbjct: 61  LAESQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLKTD--KGEWLLY 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    E ++  +V  ++ K+P PK MRW  +        ++RP+ ++  +L     
Sbjct: 119 RAHVKGESTEALVPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +K+I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  
Sbjct: 169 GDKVIPATILGIQSDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                 G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNAGKLLPNFIFVANIESKD-PTQIISGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI+ L   IA  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLQT--VLFQQQLGTLRDKTDRIQALAGWIAGQIGADVNH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+
Sbjct: 386 ATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           N ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E
Sbjct: 446 NPVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLALDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  D     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  +      + KR+  ILA   K    ++  +    L   AE  L   +    
Sbjct: 566 AVSHFRTLEEASALAAANKRVSNILA---KATEPLNDIVHASVLKEAAEIELARHLVVLR 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
             +Q      RY +    L ++  P++ FF+ V+VN  ++++R NRL+LL  ++ + L V
Sbjct: 623 DKLQPYFADGRYQEALIELAALRAPVDEFFENVMVNAKEKDIRINRLTLLSKLRELFLQV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|123444319|ref|YP_001008285.1| glycyl-tRNA synthetase subunit beta [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166227932|sp|A1JT50|SYGB_YERE8 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|122091280|emb|CAL14166.1| glycyl-tRNA synthetase beta subunit [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 689

 Score =  624 bits (1609), Expect = e-176,   Method: Composition-based stats.
 Identities = 204/722 (28%), Positives = 330/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + Y  +  Y  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELNNANLPYGEVIWYAAPRRLALKVTNLSAT 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKDT-----QFVRPVHTVTMLLGSE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I   +  I    I  GHRF       + + D Y + L+    V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSDRIIRGHRFMGEPEFTLDNADQYPQVLQERGKVIADYELRKAIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 TAGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNTKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTRPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K   +++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDKLNDHVRASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FF+ V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETVDEFFESVMVMDEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|238757318|ref|ZP_04618504.1| Glycyl-tRNA synthetase beta subunit [Yersinia aldovae ATCC 35236]
 gi|238704357|gb|EEP96888.1| Glycyl-tRNA synthetase beta subunit [Yersinia aldovae ATCC 35236]
          Length = 689

 Score =  624 bits (1609), Expect = e-176,   Method: Composition-based stats.
 Identities = 205/722 (28%), Positives = 328/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDSANLPHGEVVWYAAPRRLALKVINLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDTEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGSE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    I  GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSDRIIRGHRFMGEAEFTIDNADQYPQILLERGKVIADYELRKTIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQQIGGIADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 AAGNLMPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT   +  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRHKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNSKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTRPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDTLNDHVRASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETVDEFFDSVMVMAEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|309787763|ref|ZP_07682374.1| glycyl-tRNA synthetase beta subunit [Shigella dysenteriae 1617]
 gi|308924513|gb|EFP70009.1| glycyl-tRNA synthetase beta subunit [Shigella dysenteriae 1617]
          Length = 682

 Score =  624 bits (1609), Expect = e-176,   Method: Composition-based stats.
 Identities = 203/718 (28%), Positives = 333/718 (46%), Gaps = 61/718 (8%)

Query: 7   EIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEK 66
           EI +EE+P +     AE  +      L   G+ +  ++ +  P RL L +  L+   P++
Sbjct: 2   EIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVANLAEAQPDR 61

Query: 67  IEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRL 119
             E+ GP +       G   KA +G+ R  G+      ++     KG+  L         
Sbjct: 62  EIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAHVKGES 119

Query: 120 IEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLD 179
            E +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L      +K+I   
Sbjct: 120 TEALLPNMVATSLAKLPIPKLMRWGASD-----VHFVRPVHTVTLLL-----GDKVIPAT 169

Query: 180 LKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHRLASA 238
           +  I    +  GHRF       + + D Y   L     V+ D E R+  I  DA   A  
Sbjct: 170 ILGIQSDRVIRGHRFMGEPEFAIDNADQYPEILRERGKVIADYEERKAKIKADAEEAARK 229

Query: 239 VGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGV 298
           +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F     +G 
Sbjct: 230 IGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYFPVYANDGK 289

Query: 299 LANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFN 358
           L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+                 
Sbjct: 290 LLPNFIFVANIESKDQ-QQIISGNEKVVRPRLADAEFFFNTDR----------------- 331

Query: 359 LDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLS 418
               K L+  + RL    V+F  ++GT  ++  RI+ L   IA+ I ADV    RA +LS
Sbjct: 332 ---KKRLEDNLPRLQT--VLFQLQLGTLRDKTDRIQALAGWIAEQIGADVNHATRAGLLS 386

Query: 419 KADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVS 478
           K DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++  ++
Sbjct: 387 KCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALA 446

Query: 479 LADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED------- 531
           +ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  +++ L    E+       
Sbjct: 447 IADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGD 506

Query: 532 --------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSS 583
                    ++I F   R + +  D     D I+A+L             +K ++ F + 
Sbjct: 507 KLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKAVSHFRTL 566

Query: 584 AKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMD 643
                   + KR+  ILA   K +  +S  ++   L    E +L   +      ++    
Sbjct: 567 EAAAALAAANKRVSNILA---KSDEVLSDRVNASTLKEPEEIKLAMQVVVLRDKLEPYFA 623

Query: 644 HKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
             RY      L  + EP++ FFD+V+V VDD+E+R NRL++L+ ++ + L V ++  +
Sbjct: 624 EGRYQDALVELAELREPVDAFFDKVMVMVDDKELRINRLTMLEKLRELFLRVADISLL 681


>gi|271498623|ref|YP_003331648.1| glycyl-tRNA synthetase subunit beta [Dickeya dadantii Ech586]
 gi|270342178|gb|ACZ74943.1| glycyl-tRNA synthetase, beta subunit [Dickeya dadantii Ech586]
          Length = 689

 Score =  624 bits (1609), Expect = e-176,   Method: Composition-based stats.
 Identities = 209/724 (28%), Positives = 336/724 (46%), Gaps = 63/724 (8%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M D  FL+EI +EE+P +     AE  +      L   G+ YQ++  +  P RL L + G
Sbjct: 1   MTDKTFLVEIGTEELPPKALRTLAESFAAHFTAELDAAGLGYQSVDWFAAPRRLALKVVG 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L 
Sbjct: 61  LSASQPDREVEKRGPAIAQAFDAAGNPTKAAEGWARGCGITVSQAERL--TTDKGEWLLF 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                    + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L     
Sbjct: 119 RAHVKGEAAQTLLPGMVSTALAKLPIPKLMRWGDNDT-----QFVRPVHTVTLLL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILN 230
            +++I   +  I  G    GHRF       + + D Y +  LE   VL D + R+  I  
Sbjct: 169 GDELIPGTVLGIDSGRTLRGHRFMGEPEFTIDNADQYPQILLERGKVLADYDARKAKIKA 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
           DA   A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F
Sbjct: 229 DAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
                   L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+         
Sbjct: 289 PVYDNADKLLPNFIFVANIESKD-PQQIIAGNEKVVRPRLADAEFFFNTDR--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L+  + RL    V+F  ++GT  ++  RI  L   +A  I ADV  
Sbjct: 339 -----------KKRLEDHLPRLAT--VLFQQQLGTLRDKTDRIAALTGWVAGQIGADVEH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+
Sbjct: 386 AKRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPS 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E ++ + L    E
Sbjct: 446 SAVACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
           +                ++I F   R + +  +     D I+A+L             +K
Sbjct: 506 EAVRLYGDKLTNANVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            ++ F +  + E    + KR+  ILA   K    ++  +    L  + E +L   ++   
Sbjct: 566 AVSHFRTLEQAEALAAANKRVSNILA---KSTETLNDSVQAALLKEKEEIQLATYVTALT 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + +       RY +    L  + E ++ FFD+V+VN DD +VR NRL+LL  ++N+ L V
Sbjct: 623 SKLAPWFAEGRYQEALAELAQLRESVDNFFDKVMVNADDAQVRINRLTLLNELRNLFLKV 682

Query: 696 INVQ 699
            ++ 
Sbjct: 683 ADIS 686


>gi|332533695|ref|ZP_08409554.1| glycyl-tRNA synthetase beta chain [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036859|gb|EGI73320.1| glycyl-tRNA synthetase beta chain [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 689

 Score =  623 bits (1607), Expect = e-176,   Method: Composition-based stats.
 Identities = 213/723 (29%), Positives = 342/723 (47%), Gaps = 62/723 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   + L+EI +EE+P +   K AE  +  L   L+   + +Q +  Y +P RL L +K 
Sbjct: 1   MSAQNLLVEIGTEELPPKALRKLAEAFAANLTQELETLELAHQGVSWYASPRRLGLQVKA 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L     +K  E+ GP         G   KA  G+ R  G++      ++ D  KG   L 
Sbjct: 61  LEAKQQDKEVEKRGPATKAAFDSEGNPTKAAMGWARGCGIEVKDAQTLETD--KGAWLLH 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
           + +   +  + ++   +  A+ K+P PK MRW    +      +IRP+ ++  +      
Sbjct: 119 IAKVAGQETKTLMTDAITKALSKLPIPKPMRWGANKT-----QFIRPVHTVTILF----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            +++++ ++      N   GHRFH P  I +   D     L+ A V+ D E R+  I   
Sbjct: 169 GDELLEGEILGKQITNQLQGHRFHHPEKISINHADDVFDVLKSAYVIADYEQRKAQIRAQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
               ASAV   +  D+DLLEE+  LVEW      +F++ +L +P E +  T+K +QK F 
Sbjct: 229 IEEAASAVNAVVAMDEDLLEEVTSLVEWPVTLTATFEEAFLDVPAEALIYTMKDDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
              + G L N F+ VSNI++ D  + ++ GN +VV  RL DA  F++ D+          
Sbjct: 289 LLDQNGKLLNKFLFVSNIESKD-PSVVISGNEKVVRPRLADAQFFFETDK---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      K L+ R+  LD   V+F  ++GT  ++  RI  L   IA+ + AD  L 
Sbjct: 338 ----------KKTLESRLESLD--SVLFQKQLGTLKDKSERISELAGYIAEQLGADKDLA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EF ++QG +G  YA    E      A  E   PR   +N+PTN
Sbjct: 386 QRAGLLSKTDLMTEMVMEFTDVQGVMGMHYARHDGEAEDVAVAQNEQYMPRFAGDNLPTN 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP------- 524
            IS  V++ADK DTL+  + I + P G KDP+ALRRA +G +RI++E ++ +        
Sbjct: 446 LISCAVAIADKFDTLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELPLDILDLVAK 505

Query: 525 --------LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                   L+      ++  F   R + +  D  I  D+I+A+L       +     +K 
Sbjct: 506 SQTLFGDKLTNLNVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKA 565

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           ++ F +    E    + KR+  ILA   K +      +    L  +AEK L + ++ F T
Sbjct: 566 VSHFRTLDAAEALAAANKRVGNILA---KNDITSQGSVDESLLSDDAEKVLASQVAKFAT 622

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +        Y +    L  I E ++ FFD V+V  DD  V+ NRL+LL  +  + L + 
Sbjct: 623 DLAPLYADGNYQEALSQLAGIRESVDNFFDNVMVMADDEAVKQNRLALLNQLSGLFLGIA 682

Query: 697 NVQ 699
           ++ 
Sbjct: 683 DIS 685


>gi|254488839|ref|ZP_05102044.1| glycyl-tRNA synthetase, beta subunit [Roseobacter sp. GAI101]
 gi|214045708|gb|EEB86346.1| glycyl-tRNA synthetase, beta subunit [Roseobacter sp. GAI101]
          Length = 742

 Score =  623 bits (1606), Expect = e-176,   Method: Composition-based stats.
 Identities = 275/765 (35%), Positives = 399/765 (52%), Gaps = 89/765 (11%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +AA+DL  ++   L E G+ Y +   + TP RL L ++G+ 
Sbjct: 1   MPDLLIELFSEEIPARMQARAADDLKKLVTNGLVEAGLTYASAAAFSTPRRLTLTVQGML 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+  A +KAI+GFLR  GL    D   +++  KG++  A++RKP R  
Sbjct: 61  DASPSITEERKGPKADAPEKAIEGFLRGAGLT--RDQLEERETPKGNILFAMIRKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D++  ++   I+  PWPKSMRW           W+RPL SILCIL AED   +++ + +
Sbjct: 119 ADIVAEVLETTIRNFPWPKSMRWG-----TGTLRWVRPLHSILCILSAED-GAQVVPMTV 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             I  G  T GHRF AP  I V S D Y   L+ A V+LDP  RR+AI +DA  +A A G
Sbjct: 173 DGIDAGATTRGHRFLAPGAITVSSFDDYTAKLKRAFVVLDPAERRDAIWHDATNMAFANG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+VED  LL E+ GLVEW  V MG     +L LP E+++ ++K +QK F  R  +    
Sbjct: 233 LEVVEDAGLLAEVAGLVEWPVVLMGRIGDDFLDLPPEVLQTSMKEHQKFFSVRNPKTGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N   +D GA I+ GN +V++ARL DA  FW+ D     + + ++         
Sbjct: 293 ERFVTVANRTTADDGATILAGNEKVLSARLSDAKFFWENDLRIAQSDAGMQV-------- 344

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
                   + RL   +V FH K+GTQ E +SR+  L  ++A ++ AD     +A   +KA
Sbjct: 345 -------WVDRLS--NVTFHNKLGTQAELISRMEALAGELAPMVGADADEARQAARFAKA 395

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL +E+V EFPELQG +G  YA    ++ +   A ++H  P GP ++VPT  +SI V+LA
Sbjct: 396 DLSSEMVYEFPELQGLMGSYYAKAAGKSGAIAAAAQDHYAPLGPSDDVPTAPVSIAVALA 455

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF------------ 528
           +K+D L  FWAI+EKP+GSKDP+ALRRA LG+IRI++EN + +PL               
Sbjct: 456 EKIDKLTGFWAIDEKPTGSKDPFALRRAALGVIRILVENDLHVPLDHLHAAQLVRNKRKV 515

Query: 529 ---IEDQNLILFFHDRLKL-----------YLHDRDIRHD----LIEAILRPENDNLLTI 570
              +ED ++    H+  K            + +D+    D    L  A+     D L  +
Sbjct: 516 MPGLEDHHVEDLLHEIAKHGVFASAFQAFIHRNDKKAPTDDIAKLETAVPAKSGDLLSFL 575

Query: 571 VDL---------------------------------IKHLNEFFSSAKGEKFLLSAKRIF 597
            D                                   K LNE   +  GE  +   KR  
Sbjct: 576 HDRLKVYLKDKGIRHDIIDACIAMPGNDDLTLLVKRAKALNETLKTDDGENLIQGFKRAN 635

Query: 598 QILAIEEKKNR-EISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHS 656
            IL+  E  +  E S     ++   + E+ L+A +      I  +MD + +      + S
Sbjct: 636 NILSQAETADGVEYSFGADIKFAETDEERALFAALDAAEAQINPAMDAQDFTAAMSAMAS 695

Query: 657 ICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           +  PI+ FFD V VN D+  VR NRL+LL  I+ I   V ++ KI
Sbjct: 696 LRAPIDAFFDAVQVNSDNGTVRRNRLNLLSRIRTICTSVADLTKI 740


>gi|15602967|ref|NP_246039.1| glycyl-tRNA synthetase subunit beta [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431896|sp|P57905|SYGB_PASMU RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|12721444|gb|AAK03186.1| GlyS [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 689

 Score =  623 bits (1606), Expect = e-176,   Method: Composition-based stats.
 Identities = 205/722 (28%), Positives = 350/722 (48%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL EI +EE+P +   K A   +  +   L + G+ +++++ +  P RL + +  L+  
Sbjct: 5   NFLAEIGTEELPPKALKKLATAFAENMELELNQAGLAFESVQWFAAPRRLAVKVLALATS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P K  E+ GP V       G   KA +G+ R  G+      ++  D  KG+  +     
Sbjct: 65  QPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGISVEQAERVATD--KGEWLVHRATI 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++LK +V  A+ K+P PK MRW+          +IRP+ ++  +L      +++
Sbjct: 123 EGQPTKNLLKDMVANALAKLPIPKPMRWAD-----KTVQFIRPVHTVTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAM-VLLDPECRRNAILNDAHR 234
           I+ ++  +       GHRF      ++   D Y   L+E   V+ D   R+  IL  +  
Sbjct: 173 IEGEILGVESARTLRGHRFLGEREFQISHADQYPALLKEKGSVVADFNDRKALILAKSQE 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A+A+G     + DLL+E+  LVE+  V    F++++L +P E +  T+K +QK F    
Sbjct: 233 KATALGGVADIEDDLLDEVTSLVEYPNVLAAKFEERFLAVPAEALVYTMKGDQKYFPIYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           ++G L   FI VSNI   D  + I++GN +VV  RL DA  F+K D              
Sbjct: 293 KDGKLLPHFIFVSNINPDD-PSKIIEGNEKVVRPRLTDAEFFFKTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L + L+ ++ RL+   V+F  ++GT  ++ +RI  L  +IA+ I AD     RA
Sbjct: 338 ------LKQRLEDQLPRLET--VLFQQQLGTLRDKTARIEQLAGEIAKQIGADEVKAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E+     A+ E   PR   + +P + ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V+LADK DTL   + I ++P GS DP+ALRRA LG +RII+E  + + L++ ++    
Sbjct: 450 SAVALADKFDTLTGIFGIGQQPKGSADPFALRRAALGALRIIVEKNLPLDLAEIVKKSSA 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                       ++++ F   R + +  D  I  D+I+A+L             ++ ++ 
Sbjct: 510 LFGDKLTNANVVEDVVEFMLGRFRAWYQDEGIAVDVIQAVLARRPTKPSDFDARVRAVSH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E    + KR+  ILA   K   E+   I        AEK L   +      + 
Sbjct: 570 FRALEAAEALAAANKRVSNILA---KVEGELPANIDTTLCAEAAEKVLAEQVIALQAELA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y    D L ++ EP++ FFD V+VN ++ ++R NRL++L  ++N+ L V ++ 
Sbjct: 627 PLFAKGEYQVALDRLAALREPVDTFFDNVMVNAENPQLRQNRLAILNNLRNLFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|323703326|ref|ZP_08114976.1| glycyl-tRNA synthetase, beta subunit [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531689|gb|EGB21578.1| glycyl-tRNA synthetase, beta subunit [Desulfotomaculum nigrificans
           DSM 574]
          Length = 694

 Score =  623 bits (1606), Expect = e-176,   Method: Composition-based stats.
 Identities = 225/732 (30%), Positives = 344/732 (46%), Gaps = 71/732 (9%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  DFLLEI  EE+PAR    A   L  +    L+E+ ++Y ++  Y TP RL LY+K  
Sbjct: 1   MAKDFLLEIGIEEMPARFLAPALAQLKELTAKTLQEQRIVYGDIATYGTPRRLVLYVKDA 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           +       +E  GP         G   KAI GF+RS G+       + +   + +   AV
Sbjct: 61  AEDQAPLEKEVKGPAKKAAFDIDGNPTKAIQGFMRSQGVSLED--LVVRHIGQVEYLYAV 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
            R+  R   DVL  I P  I  + +PK MRW +         + RP++ +L +       
Sbjct: 119 KREAGRPTADVLAEICPALITGLHFPKPMRWGSLE-----MRFARPIRWLLALF-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
           + ++  +L  +    ITYGHRF     + + +   Y   + +A VL+DP  R+  I    
Sbjct: 169 DDVVPFELANLKSNRITYGHRFLTTGDLPIANPADYFDRIRKAYVLIDPVERKEVIRQQV 228

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
             LA+A G ++  D+DLL+EI  +VEW     GSFD+ YL LP  ++   ++ +Q+ F  
Sbjct: 229 QELAAAEGGQVEMDEDLLDEITNIVEWPTALCGSFDRDYLKLPAAVLVTPMREHQRYFPV 288

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              +G L N FI V N         +  GN +V+ ARL DA  F++ D            
Sbjct: 289 LGPDGQLLNKFIAVRNG-TKAYLDIVTAGNEKVLRARLADAAFFFEED------------ 335

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL-- 410
                   L KPL  ++  L    VVF   +GT  ++V RI  L   +A+L+ AD     
Sbjct: 336 --------LKKPLASKVDGLK--KVVFLEGLGTVADKVDRIGALADHLAELLGADEQQQE 385

Query: 411 -VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVP 469
            + RA +L+KADL T +V EFPELQG +G+EYA+   E+    +AI +H  PR   + +P
Sbjct: 386 KIQRAALLAKADLVTNMVYEFPELQGVMGREYALRNGEDPDVAEAIFQHYLPRFAGDQLP 445

Query: 470 TNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFI 529
                  +SLADK+DT++  +AI  +P+GS DPYALRR  LGI  II E  + + L Q I
Sbjct: 446 NTLAGRVLSLADKMDTIVGCFAIGIQPTGSADPYALRRQALGICHIITEGNLHLSLKQMI 505

Query: 530 E-------------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTI 570
           E                      +  FF  R+K  + DR + +D +EA+L    D++   
Sbjct: 506 EWAYQGYSAEVELKYTLPQVAGEIEEFFKQRIKGMMSDRGLSYDTVEAVLAVGFDDITDA 565

Query: 571 VDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAV 630
                 L  F         + +  R   +              I+  YL   AE  LY  
Sbjct: 566 FARGAALTSFRDQPAFNALMTAFNRANNLAKNA------TGGAINEAYLEHPAEHELYRQ 619

Query: 631 ISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKN 690
           ++     +Q  +  + Y      + +I  P+  FF+QV+V V+D  ++ NRL+LL+ + +
Sbjct: 620 LTALTQKVQPLIQSRDYVAALREIAAIQAPLNEFFEQVMVMVEDERIKTNRLALLKNLVD 679

Query: 691 IILIVINVQKIV 702
           +   V +  K+V
Sbjct: 680 LSKTVADFSKVV 691


>gi|170719266|ref|YP_001746954.1| glycyl-tRNA synthetase subunit beta [Pseudomonas putida W619]
 gi|229558569|sp|B1J425|SYGB_PSEPW RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|169757269|gb|ACA70585.1| glycyl-tRNA synthetase, beta subunit [Pseudomonas putida W619]
          Length = 683

 Score =  622 bits (1605), Expect = e-176,   Method: Composition-based stats.
 Identities = 208/724 (28%), Positives = 342/724 (47%), Gaps = 65/724 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALATLGDAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPRV------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           L    P++     GP +      G   +A  GF +  G++     Q       G      
Sbjct: 61  LDVQQPDRSINIDGPPLQAAFKDGEPTQAALGFAKKCGVELSEIDQS------GAKLRFS 114

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
              P +    +L TIV  ++  +P PK MRW+ +        ++RP + ++ +L      
Sbjct: 115 QHIPGKATASLLPTIVEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL-----G 164

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
           ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I    
Sbjct: 165 DQVVDCTILSQQAGRESRGHRFHHPQNVVITTPANYVEDLRKAYVLADFAERRELIAKRT 224

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
             LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F  
Sbjct: 225 TELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFCL 284

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              EG L   FI V+N+++ D    IV GN +VV  RL DA  F+K+D+           
Sbjct: 285 LDSEGKLLPRFITVANVESRD-PKQIVSGNEKVVRPRLTDAEFFFKQDK----------- 332

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD 412
                     +PL+    RL   +VVF A++GT  ++  R+  L   IA LI  D     
Sbjct: 333 ---------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSRLAAYIAPLIGGDAQRAG 381

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P   
Sbjct: 382 RAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTL 441

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED- 531
               V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E  
Sbjct: 442 TGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTPAVEFA 501

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHL 577
                         + ++ F  DRL+    D  I      ++   +  + L     ++ +
Sbjct: 502 VKQFGAKVKAAGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALKPGSALDFDQRVQAV 561

Query: 578 NEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTH 637
             F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I      
Sbjct: 562 QAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQA 618

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
           +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V +
Sbjct: 619 VQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVAD 678

Query: 698 VQKI 701
           +  +
Sbjct: 679 ISLL 682


>gi|221638266|ref|YP_002524528.1| glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides KD131]
 gi|221159047|gb|ACM00027.1| Glycyl-tRNA synthetase subunit beta [Rhodobacter sphaeroides KD131]
          Length = 728

 Score =  622 bits (1605), Expect = e-176,   Method: Composition-based stats.
 Identities = 268/752 (35%), Positives = 393/752 (52%), Gaps = 77/752 (10%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           MPD L+E++SEEIPARMQ +A EDL  ++   L E G+ Y +   + TP RL L ++GLS
Sbjct: 1   MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGAFSTPRRLVLSVEGLS 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
             SP   EER GP+  A   AI+GFLRSTGL         +  KKG V  AV+ KP R  
Sbjct: 61  AESPTLREERKGPKADAPAAAIEGFLRSTGLTRDRLET--RADKKGAVLFAVVEKPGRPA 118

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            +++  ++   I+  PWPKSMRW        +  W+RPL+SILC+L  E    +++ + L
Sbjct: 119 PEIVAEVLERTIRTFPWPKSMRWG-----TGSLRWVRPLQSILCLLSDE-GGAEVVPMTL 172

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
             +  GN T GHRF AP    V   D Y   L  A V+LD   R  AI ++A   A A G
Sbjct: 173 DGLTAGNSTEGHRFMAPARFAVSGFDDYRAKLARAFVMLDASEREQAIWHEATTQAFAQG 232

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           LE+V D  LL E+ GLVEW  V MG+  + +L LP E+++ +++ +QK F          
Sbjct: 233 LEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKFFSVTNPATGRI 292

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
             F+ V+N + +D G  I++GN +V++ARL DA  FW+ D   +                
Sbjct: 293 EKFVTVANRETADHGETILKGNGKVLSARLSDARFFWENDLRTVKTAG------------ 340

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
               L+     L    V FH ++G+Q +R++RI  L ++IA L+ A   L   A  ++KA
Sbjct: 341 ----LEGMAEGLKQ--VTFHNRLGSQADRIARIEALAREIAPLVGASPDLAAEAARVAKA 394

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DL + +V EFPELQG +G  YA       +   A + H +P GP + VPT+ +S  V+LA
Sbjct: 395 DLQSAMVGEFPELQGTMGTYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSGAVALA 454

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKID------------------ 522
           DK+DTL  FWAI+EKP+GSKDP+ALRRA LG++R+ LEN++                   
Sbjct: 455 DKIDTLTGFWAIDEKPTGSKDPFALRRAALGVVRLNLENELRYSLKLLLLDGLVANEIAR 514

Query: 523 --------------------------IPLSQFIEDQN-----LILFFHDRLKLYLHDRDI 551
                                       L    +  N     L+ FFHDRLK++L ++ I
Sbjct: 515 QFTHFKSETNALAGIDDVEAFKQHVTFSLDAAKDKANDLFEYLLAFFHDRLKVHLREQGI 574

Query: 552 RHDLIEAILR-PENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNR-E 609
           RHD+I+A L  P ND+L  +V   + L+ F  +  G   L   KR   IL   E K+  E
Sbjct: 575 RHDVIDACLAMPGNDDLTLLVKRAEALSGFLKTDDGTNLLQGFKRANNILTQAEAKDGVE 634

Query: 610 ISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVL 669
            S    P++   +AE+ L++ +      I  ++  + +      + ++  PI+ FF+ V 
Sbjct: 635 YSFGADPKFAETDAERALFSALETAEAAIGPALQAEDFAAAMSAMAALRAPIDAFFETVQ 694

Query: 670 VNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
           VN D+  +R NRL++L  I+     V ++ +I
Sbjct: 695 VNADNAVLRRNRLNMLHSIRATCARVADLTRI 726


>gi|197334221|ref|YP_002154788.1| glycyl-tRNA synthetase, beta subunit [Vibrio fischeri MJ11]
 gi|238690288|sp|B5FEW0|SYGB_VIBFM RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|197315711|gb|ACH65158.1| glycyl-tRNA synthetase, beta subunit [Vibrio fischeri MJ11]
          Length = 688

 Score =  622 bits (1604), Expect = e-176,   Method: Composition-based stats.
 Identities = 210/725 (28%), Positives = 347/725 (47%), Gaps = 63/725 (8%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +FL+E+ +EE+P       AE  +      LK   + +Q ++ Y TP RL L +  L
Sbjct: 1   MAKNFLIELGTEELPPTALRSLAEAFASNFEAELKAADLAHQGVKWYATPRRLALKVAEL 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           +    +K+ E+ GP V       G   KA  G+ R  G+      ++K D  KG+  L  
Sbjct: 61  AESQADKVVEKRGPAVSAAFDADGNPTKAAQGWARGNGITVEQAERLKTD--KGEWLLHK 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
                + +++++      A+  +P PK+MRW  +        +IRP+K++  +L      
Sbjct: 119 EEVKGKPVQELVVDFAAKALAGLPIPKAMRWGNSD-----IQFIRPVKTLTILL-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILND 231
           +++I+  +  +       GHRF       + S D Y   LE    V+ D + R+  IL D
Sbjct: 169 DELIEGSILGVSSARTLRGHRFMGESEFTIDSADQYPAILEERGKVMADYDARKAIILAD 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
           + + A+AVG +   + DL+EE+  LVEW  V    F++++L +P E +  T+K +QK F 
Sbjct: 229 SEKAAAAVGGKADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPSEALVYTMKGDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
                  L   FI VSNI++ +    +++GN +VV  RL DA  F+  D+          
Sbjct: 289 VYDENKKLLPNFIFVSNIESKE-PRHVIEGNEKVVRPRLADAEFFFNTDR---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL  R+  L+    +F  ++GT  ++  RI  L   IA+ I ADV   
Sbjct: 338 ----------KRPLIDRLPELEQA--IFQKQLGTIKDKTDRITELAGYIAEQIGADVEKS 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +L+K DL T +V EF + QG +G  YA    E+     A+ E   PR   +++P+ 
Sbjct: 386 QRAGLLAKCDLMTSMVFEFTDTQGVMGMHYATHDGEDEQVALALYEQYMPRFAGDDLPST 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
            IS +V++ADKLDTL+  + I + P GS DP+ALRRA LG++RII+E + ++ L   +  
Sbjct: 446 DISASVAMADKLDTLVGIFGIGQAPKGS-DPFALRRAALGVLRIIVEKEYNLDLVDLVAK 504

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                           ++I F   R + +  D     D+I+A+L             +K 
Sbjct: 505 AQSLFGDKLSNANVATDVIDFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDKRVKA 564

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           ++ F      E    + KR+  ILA   K + E++ EI    L  +AEK L   +     
Sbjct: 565 VSHFRELDAAESLAAANKRVGNILA---KFDGELAQEIDLALLQEDAEKALAEKVEILAE 621

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            ++       Y +    L  + EP++ FFD V+V  DD  ++ NRL+LL  ++N+ L + 
Sbjct: 622 ALEPVFAAGNYQEALSRLAELREPVDAFFDNVMVMADDEALKTNRLTLLNKLRNLFLDIA 681

Query: 697 NVQKI 701
           ++  +
Sbjct: 682 DISLL 686


>gi|167031097|ref|YP_001666328.1| glycyl-tRNA synthetase subunit beta [Pseudomonas putida GB-1]
 gi|189082270|sp|B0KF22|SYGB_PSEPG RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|166857585|gb|ABY95992.1| glycyl-tRNA synthetase, beta subunit [Pseudomonas putida GB-1]
          Length = 683

 Score =  622 bits (1604), Expect = e-176,   Method: Composition-based stats.
 Identities = 208/724 (28%), Positives = 342/724 (47%), Gaps = 65/724 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPR------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           L    P++     GP        G   +A  GF +  G++     Q       G      
Sbjct: 61  LDVQQPDRSINIDGPPMQAAFKDGEPTQAALGFAKKCGVELAEIDQS------GAKLRFS 114

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
              P +    +L TI+  ++  +P PK MRW+ +        ++RP + ++ +L      
Sbjct: 115 QHIPGKATASLLPTIIEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL-----G 164

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
           ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I    
Sbjct: 165 DQVVDCTILSQKAGRESRGHRFHHPENVVITTPANYVEDLRKAYVLADFAERRELISKRT 224

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
             LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F  
Sbjct: 225 AELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFCL 284

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              EG L   FI V+N+++ D    IVQGN +VV  RL DA  F+K+D+           
Sbjct: 285 LDSEGKLLPRFITVANVESRD-PKQIVQGNEKVVRPRLTDAEFFFKQDK----------- 332

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD 412
                     +PL+    RL   +VVF A++GT  ++  R+  L   IA LI  D     
Sbjct: 333 ---------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSKLAAFIAPLIGGDAQRAG 381

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P   
Sbjct: 382 RAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTL 441

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED- 531
               V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E  
Sbjct: 442 TGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLNLTGAVEFA 501

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHL 577
                         + ++ F  DRL+    D  I      ++   +  + L     ++ +
Sbjct: 502 VKQFGAKVKAAGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAV 561

Query: 578 NEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTH 637
             F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I      
Sbjct: 562 QAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQA 618

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
           +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V +
Sbjct: 619 VQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVAD 678

Query: 698 VQKI 701
           +  +
Sbjct: 679 ISLL 682


>gi|77456237|ref|YP_345742.1| glycyl-tRNA synthetase subunit beta [Pseudomonas fluorescens Pf0-1]
 gi|123772394|sp|Q3KKF3|SYGB_PSEPF RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|77380240|gb|ABA71753.1| glycyl-tRNA synthetase beta chain [Pseudomonas fluorescens Pf0-1]
          Length = 684

 Score =  622 bits (1604), Expect = e-176,   Method: Composition-based stats.
 Identities = 205/725 (28%), Positives = 335/725 (46%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +  +  AE     +   L+  G+ Y++   Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKALNTLAEAFLAGIDKGLQAAGLNYESKTVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G++     Q       G     
Sbjct: 61  LATQQPDRSINLDGPPRQAAFDADGNPTQAALGFAKKCGVELSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P PK MRW           ++RP + ++ +L     
Sbjct: 115 SQNIAGKPTASLLPTIVEDSLNDLPIPKRMRWGARKE-----EFVRPTQWLVMLL----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++IID  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQIIDCTILAQKAGRESRGHRFHHPQSVRIGSPSSYLADLRAAYVLADANERREIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 TEELATRQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLDVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI V+NI++ D    I+ GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDADGKLLPRFITVANIESKD-PQQIIAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF  K+G+  ++  R+  L   IA  I  + +  
Sbjct: 334 ----------KQKLEAFNDRLQ--NVVFQEKLGSVYDKAERVSKLAAYIAARIGGNASWA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P  
Sbjct: 382 ARAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPAT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE- 530
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +  
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLNDAVAF 501

Query: 531 --------------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                         +  ++ F  DRL+    D  +      ++   +  + L     ++ 
Sbjct: 502 AVNAFGAKVKAAGLNDAVLEFIFDRLRARYEDEGVGVATYLSVRALKPGSALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+   K    +  E+  +Y     E  LY+ I     
Sbjct: 562 VQAFRKLPEAAALAAVNKRVSNLLS---KVEGSVPTEVQAKYFDNANEFSLYSAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y++    L ++ EP++ FFD V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAARQYNESLARLAALREPVDAFFDAVMVNAEDANVRANRYALLARLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|26986805|ref|NP_742230.1| glycyl-tRNA synthetase subunit beta [Pseudomonas putida KT2440]
 gi|38258507|sp|Q88RR9|SYGB_PSEPK RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|24981401|gb|AAN65694.1|AE016196_5 glycyl-tRNA synthetase, tetrameric type, beta subunit [Pseudomonas
           putida KT2440]
          Length = 684

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 209/725 (28%), Positives = 344/725 (47%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L    P++     GP +       G   +A  GF +  G+      +I +   K      
Sbjct: 61  LDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGV---ELAEIDQSGPK---LRF 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
               P +    +L TIV  ++  +P PK MRW+ +        ++RP + ++ +L     
Sbjct: 115 SQHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I   
Sbjct: 165 GDQVVDCTILSQKAGRESRGHRFHHPENVLITTPANYVEDLRKAYVLADFAERRELISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 TAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+N+++ D    IVQGN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDSEGKLLPRFITVANVESRD-PKQIVQGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL+    RL   +VVF A++GT  ++  R+  L   IA LI  D    
Sbjct: 334 ----------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P  
Sbjct: 382 GRAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  I      ++   +  + L     ++ 
Sbjct: 502 AVKQFGAKIKAPGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|59710623|ref|YP_203399.1| glycyl-tRNA synthetase subunit beta [Vibrio fischeri ES114]
 gi|81311051|sp|Q5E8Y5|SYGB_VIBF1 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|59478724|gb|AAW84511.1| glycyl-tRNA synthetase, beta subunit [Vibrio fischeri ES114]
          Length = 688

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 210/725 (28%), Positives = 346/725 (47%), Gaps = 63/725 (8%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +FL+E+ +EE+P       AE  +      LK   + +Q ++ Y TP RL L +  L
Sbjct: 1   MAKNFLIELGTEELPPTALRSLAEAFASNFEAELKAADLAHQGVKWYATPRRLALKVAEL 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           +    +K+ E+ GP V       G   KA  G+ R  G+      ++K D  KG+  L  
Sbjct: 61  AESQADKVVEKRGPAVSAAFDADGNPTKAAQGWARGNGITVEQADRLKTD--KGEWLLHK 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
                + +++++      A+  +P PK+MRW  +        +IRP+K++  +L      
Sbjct: 119 EEVKGKPVQELVVDFAAKALAGLPIPKAMRWGNSD-----IQFIRPVKTLTILL-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILND 231
           +++I+  +  +       GHRF       + S D Y   LE    V+ D + R+  IL D
Sbjct: 169 DELIEGSILGVSSARTLRGHRFMGESEFTIDSADQYPAILEERGKVMADYDARKAIILAD 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
           + + A+AVG +   + DL+EE+  LVEW  V    F++++L +P E +  T+K +QK F 
Sbjct: 229 SEKAAAAVGGKADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPSEALVYTMKGDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
                  L   FI VSNI++ +    +++GN +VV  RL DA  F+  D+          
Sbjct: 289 VYDENKKLLPNFIFVSNIESKE-PRHVIEGNEKVVRPRLADAEFFFNTDR---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL  R+  L+    +F  ++GT  ++  RI  L   IA+ I ADV   
Sbjct: 338 ----------KRPLIDRLPELEQA--IFQKQLGTIKDKTDRITELAGYIAEQIGADVEKS 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +L+K DL T +V EF + QG +G  YA    E+     A+ E   PR   +++P+ 
Sbjct: 386 QRAGLLAKCDLMTSMVFEFTDTQGVMGMHYATHDGEDEQVALALYEQYMPRFAGDDLPST 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
            IS  V++ADKLDTL+  + I + P GS DP+ALRRA LG++RII+E + ++ L   +  
Sbjct: 446 DISSAVAMADKLDTLVGIFGIGQAPKGS-DPFALRRAALGVLRIIVEKEYNLDLVDLVAK 504

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                           ++I F   R + +  D     D+I+A+L             +K 
Sbjct: 505 AQSLFGDKLSNANVATDVIDFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDKRVKA 564

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           ++ F      E    + KR+  ILA   K + E++ EI    L  +AEK L   +     
Sbjct: 565 VSHFRELDAAESLAAANKRVGNILA---KFDGELAQEIDLALLQEDAEKALAEKVEILAE 621

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            ++       Y +    L  + EP++ FFD V+V  DD  ++ NRL+LL  ++N+ L + 
Sbjct: 622 ALEPVFAAGNYQEALSRLAELREPVDAFFDNVMVMADDEALKTNRLTLLNKLRNLFLDIA 681

Query: 697 NVQKI 701
           ++  +
Sbjct: 682 DISLL 686


>gi|268592254|ref|ZP_06126475.1| glycyl-tRNA synthetase, beta subunit [Providencia rettgeri DSM
           1131]
 gi|291312029|gb|EFE52482.1| glycyl-tRNA synthetase, beta subunit [Providencia rettgeri DSM
           1131]
          Length = 689

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 197/722 (27%), Positives = 337/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  +  P RL L +  L+  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDGADIAHGAVTWFAAPRRLALKVADLAAS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L   + 
Sbjct: 65  QPDREIEKRGPAISQAFGPDGQPTKAAEGWARGCGITVDQAERL--TTDKGEWLLYRAQM 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             + + ++L  +V  A+ K+P PK MRW+   +      ++RP+ ++  +L ++     +
Sbjct: 123 KGQAVSELLADMVSRALAKLPIPKLMRWADKDT-----QFVRPVHTVTLLLGSD-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           ID ++  I  G    GHRF       + + + Y   L     V+ D   R+  I  DA +
Sbjct: 173 IDGEILGIKSGRTIRGHRFMGESEFTIDNAEQYPAILRERGKVMADYAERKAVIKADAEK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A A+G +      LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQALGGQADLTDSLLEEVTSLVEWPVVLTAKFEEKFLDVPSEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           + G L   FI V+NI++SD    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 KTGKLMPNFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  R+  L   IA  I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQKQLGTLRDKTDRLEALAGWIANKIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +L+K DL T +V EF + QG +G  YA    E+     A++E  +PR   + +P+  +S
Sbjct: 390 GLLAKCDLMTNMVFEFTDTQGVMGMHYARHDGESEDVALALKEQYQPRFSGDALPSTDVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             ++LA+K+DTL   + I + P G KDP+ALRRA LG++RII+E    + L +  E+   
Sbjct: 450 AALALAEKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKGYQLDLVEMTEEAAR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  +     D I+A+L             +K +  
Sbjct: 510 LYGDKLTNKNVVNDVVEFMLGRFRSWYQELGYSIDTIQAVLARHPTQPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S  + +    + KR+  IL+  E+K   ++  +    L    E +L   +      + 
Sbjct: 570 FRSLEEAQALAAANKRVSNILSKSEEK---LADNVLASVLKTPEEVKLATHVVVLQDKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                + Y +    L S+ + ++ FF  V+V  +D+ VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PMFAERNYQEALVELASLRDIVDEFFANVMVMDEDQAVRINRLTLLSQLRELFLKVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|313496432|gb|ADR57798.1| GlyS [Pseudomonas putida BIRD-1]
          Length = 684

 Score =  622 bits (1603), Expect = e-176,   Method: Composition-based stats.
 Identities = 209/725 (28%), Positives = 344/725 (47%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L    P++     GP +       G   +A  GF +  G+      +I +   K      
Sbjct: 61  LDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGV---ELAEIDQSGPK---LRF 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
               P +    +L TIV  ++  +P PK MRW+ +        ++RP + ++ +L     
Sbjct: 115 SQHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I   
Sbjct: 165 GDQVVDCTILSQKAGRESRGHRFHHPENVLITTPANYVEDLRKAYVLADFAERRELISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 TAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+N+++ D    IVQGN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDNEGKLLPRFITVANVESRD-PKQIVQGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL+    RL   +VVF A++GT  ++  R+  L   IA LI  D    
Sbjct: 334 ----------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P  
Sbjct: 382 GRAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  I      ++   +  + L     ++ 
Sbjct: 502 AVKQFGAKVKAPGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|85057990|ref|YP_453692.1| glycyl-tRNA synthetase subunit beta [Sodalis glossinidius str.
           'morsitans']
 gi|123739018|sp|Q2NX38|SYGB_SODGM RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|84778510|dbj|BAE73287.1| glycyl-tRNA synthase beta subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 689

 Score =  621 bits (1602), Expect = e-175,   Method: Composition-based stats.
 Identities = 209/723 (28%), Positives = 338/723 (46%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
             FL+EI +EE+P +     AE  +I + G L    V +  +  +  P RL + +  L  
Sbjct: 4   HTFLVEIGTEELPPKALRALAEAFAIHISGELDAANVRHGEVSWFAAPRRLAVKVAALGG 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
              +   E+ GP +       G   KA +G+ R  G+      ++  D  KG+  +   R
Sbjct: 64  AQADSDVEKRGPAIAQVFDADGNPTKAAEGWARGCGITVSQAERLATD--KGEWLVYRAR 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
              + ++++L  +V  A+ K+P PK MRW    +      +IRP+ ++  +L      + 
Sbjct: 122 VKGQPVQELLCAVVSRALGKLPIPKMMRWGDNET-----QFIRPVHTVTLLL-----DDG 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAH 233
           +I  ++  I    I  GHRF     I ++  D Y +  L+   V+ D   R+  I  DA 
Sbjct: 172 VIAGNVLGIDADRIVRGHRFMGEREISLEHADQYPQVLLDRGRVMADYLQRKETIRRDAE 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
             A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F   
Sbjct: 232 EAAKRLGGVADLSESLLEEVTSLVEWPVVLTARFEEKFLAVPAEALVYTMKGDQKYFPVY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
              G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D             
Sbjct: 292 DAAGNLLPHFIFVANIESKD-PQQIIAGNEKVVRPRLADAEFFFNTDH------------ 338

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    + L+ R+ RLD   V+F  ++GT  ++  RI  L   IA  I ADV    R
Sbjct: 339 --------KQRLEDRLPRLDT--VLFQKQLGTLRDKSDRIEALSAWIAGRIGADVPQAAR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF + QG +G  YA    E  +   A +E  +PR   + +PT  +
Sbjct: 389 AGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEPEAVALAQKEQYQPRFAGDALPTTLV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           S  V++ADK+DTL   + I + P G KDP+ALRRATLG++RII+E ++ + L    E+  
Sbjct: 449 SCAVAIADKMDTLAGIFGIGQHPKGDKDPFALRRATLGVLRIIVEKQLPLDLQTLTEEAV 508

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                         ++I F   R + +  ++    D I+A+L             ++ ++
Sbjct: 509 RLYGEKLTNDAVVNDVIDFMLGRFRAWYQEQGHSVDTIQAVLARRPTRPADFDARVRAVS 568

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F +  +      + KR+  ILA   K +  +  ++    L   +E  L   +      +
Sbjct: 569 YFRTLEEAASLAAANKRVSNILA---KSDDPVYKDLQASVLKDPSEITLATHLVVLREKL 625

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           Q   +  RY      L ++ EP++ FFD V+V  DD +VR NRL+LL  ++ + L V ++
Sbjct: 626 QPLFEAGRYQDALVELAALREPVDAFFDSVMVMADDPQVRINRLTLLAQLRKLFLQVADI 685

Query: 699 QKI 701
             +
Sbjct: 686 SLL 688


>gi|77358988|ref|YP_338563.1| glycyl-tRNA synthetase subunit beta [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123730516|sp|Q3IJ28|SYGB_PSEHT RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|76873899|emb|CAI85120.1| glycyl-tRNA synthetase, beta subunit [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 689

 Score =  621 bits (1601), Expect = e-175,   Method: Composition-based stats.
 Identities = 211/723 (29%), Positives = 344/723 (47%), Gaps = 62/723 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   + L+EI +EE+P +   K AE  +  L   L+   + +Q +  Y +P RL L +  
Sbjct: 1   MSAQNLLVEIGTEELPPKALRKLAEAFAANLTAELETLELAHQGVSWYASPRRLGLRVIA 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L     +K  E+ GP +       G   KA  G+ R  G++      ++ D  KG   L 
Sbjct: 61  LDAKQQDKEVEKRGPAIKAAFDADGNPTKAAMGWARGCGIEVKDAQTLETD--KGAWLLH 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
           + +   +  + ++  ++  A+ K+P PK MRW    +      +IRP+ ++  +L     
Sbjct: 119 LAKVAGQETKTLMVDVINKALAKLPIPKPMRWGANKT-----QFIRPVHTVTILL----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++  ++      N   GHRFH P  I +   D     L+ A V+ D E R+  I   
Sbjct: 169 GDELVTGEVLGKQVSNQLQGHRFHHPEKITINHADDIFDVLKSAYVIADYEQRKAQIRAQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
               A A+   +  D+DLLEE+  LVEW      +F++++L +P E +  T+K +QK F 
Sbjct: 229 IEAAAKAINAVVAMDEDLLEEVTSLVEWPVTLTATFEEEFLAVPAEALIYTMKDDQKYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
              + G L N F+ VSNI++ D  + ++ GN +VV  RL DA  F++ D+          
Sbjct: 289 LLDQNGKLLNKFLFVSNIESKD-PSVVISGNEKVVRPRLADAQFFFESDK---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      K L+ R+  LD   V+F  ++GT  ++ +RI  L   IAQ + AD  L 
Sbjct: 338 ----------KKTLESRLESLD--SVLFQKQLGTLKDKSARISELAGYIAQQLGADKELA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EF ++QG +G  YA    E      A  E   PR   +++PTN
Sbjct: 386 QRAGLLSKTDLMTEMVMEFTDIQGVMGMHYARFDGEAEDVALAQNEQYMPRFAGDSLPTN 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIP------- 524
            IS  V++ADK DTL+  + I + P G KDP+ALRRA +G +RI++E ++ +        
Sbjct: 446 LISCAVAIADKFDTLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELPLDILDLVAK 505

Query: 525 --------LSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                   L+      ++  F   R + +  D  I  D+I+A+L       +     +K 
Sbjct: 506 SQTLFGDKLTNLNVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKA 565

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           ++ F +    E    + KR+  ILA   K +      +    L  +AEK L A ++ F T
Sbjct: 566 VSHFRTLDAAEALAAANKRVSNILA---KNDITSEGNVDESLLTDDAEKVLAAQVAKFAT 622

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +        Y +    L  I + ++ FFD V+V  DD  V+ NRL+LL  +  + L + 
Sbjct: 623 ELAPLYASGNYQEALSQLAGIRQSVDSFFDNVMVMADDEAVKQNRLALLSQLSGLFLGIA 682

Query: 697 NVQ 699
           ++ 
Sbjct: 683 DIS 685


>gi|119947319|ref|YP_944999.1| glycyl-tRNA synthetase, beta subunit [Psychromonas ingrahamii 37]
 gi|166227922|sp|A1T0Y5|SYGB_PSYIN RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|119865923|gb|ABM05400.1| glycyl-tRNA synthetase, beta subunit [Psychromonas ingrahamii 37]
          Length = 688

 Score =  621 bits (1601), Expect = e-175,   Method: Composition-based stats.
 Identities = 211/724 (29%), Positives = 350/724 (48%), Gaps = 63/724 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   + L+E+ +EE+P +   + AE  +  +   L +  + + ++R   +P RL L +  
Sbjct: 1   MAQENLLIELGTEELPPKSLRQLAESFASNVEAELNKAELSFDSVRWLASPRRLALVIAN 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS    +KI E+ GP V       G   KA  G+ RS G+      ++  D  KG+  L 
Sbjct: 61  LSDSQADKIVEKRGPAVNVAFDAEGQATKAAQGWARSNGITVEQAERLITD--KGEWLLF 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                   + +++  I   A+ K+P  K MRW +     S+  +IRP+ ++  +  +   
Sbjct: 119 KSEVKGLSVAELIPEIAANALAKLPISKPMRWGS-----SSTQFIRPVHTVTMLFGS--- 170

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEE-AMVLLDPECRRNAILN 230
             ++I  +L  +    I  GHRF     + +   D Y   L++   V++D E R+  I +
Sbjct: 171 --RLIQGELLGVASDRIIRGHRFLGEAELIIDHADQYETLLDDSGKVIVDYERRKAIIRD 228

Query: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCF 290
               LA+        D+ LLEE+  LVEW    +GSF+ K+L +P E +  T+K NQK F
Sbjct: 229 QVEALAAHENGVADIDESLLEEVTSLVEWPVTLVGSFEDKFLDVPSEALIYTMKDNQKYF 288

Query: 291 VTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSL 350
               ++G L   FI VSNI + D  A ++ GN +V+  RL DA  F++ D+         
Sbjct: 289 PVLDKDGKLLPRFIFVSNIVSRD-PAQVISGNEKVIRPRLADAEFFFETDK--------- 338

Query: 351 KESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVAL 410
                       K L  R+  L    V+F  K+GT  E+  RI  + + IA  I AD   
Sbjct: 339 -----------KKTLASRLESLS--SVLFQQKLGTLKEKSERIANVAEDIALQIKADTKH 385

Query: 411 VDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPT 470
             RA +LSK DL T++V EFP++QG +G  YA+   E      A+ E   PR   + +PT
Sbjct: 386 AQRAGLLSKTDLMTDMVMEFPDVQGIMGMHYALHDGEEQEVAIALNEQYLPRFAGDKLPT 445

Query: 471 NKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE 530
           + ++  VSLADKLDTL+  + I + P G+ DP+ALRRA +G++RII    +D+ L + +E
Sbjct: 446 SLVACAVSLADKLDTLVGIFGIGQAPKGAADPFALRRAAIGLLRIITNKNLDLDLVELVE 505

Query: 531 D---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIK 575
                           Q+++ F   R +          +LI+++L       +     ++
Sbjct: 506 IAKLQYGHKLTNDNVVQDVVDFLFARFRATYQANGYSVELIQSVLVRRPTKPVDFEKRLQ 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            + +F +  +      + KRI  ILA   K   EI+ ++ P  L   AE +L  ++    
Sbjct: 566 AVAKFQTLPEAAPIAAANKRISNILA---KVKGEINAQVDPSLLQEPAEIKLSEILGSLE 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
           + ++   D+  Y      L S+ EP++ FFD V+V  +D  ++ NRL++L  ++N+ L +
Sbjct: 623 STLRPLFDNLDYESALFELASLNEPVDEFFDNVMVMAEDPAIKANRLAILNRLRNLFLQI 682

Query: 696 INVQ 699
            +V 
Sbjct: 683 ADVS 686


>gi|332163498|ref|YP_004300075.1| glycyl-tRNA synthetase subunit beta [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607999|emb|CBY29497.1| glycyl-tRNA synthetase beta chain [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667728|gb|ADZ44372.1| glycyl-tRNA synthetase subunit beta [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861718|emb|CBX71892.1| glycyl-tRNA synthetase beta subunit [Yersinia enterocolitica
           W22703]
          Length = 689

 Score =  620 bits (1600), Expect = e-175,   Method: Composition-based stats.
 Identities = 200/722 (27%), Positives = 329/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL + +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELNSANLPHGEVVWYAAPRRLAVKVANLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTMLLGSE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSDRVIRGHRFMGESEFALDNADQYPQVLLERGKVIADYELRKAIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 TAGHLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RI++E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRILVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNTKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTRPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K   +++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDKLNDHVRASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FF+ V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETVDEFFESVMVMDEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|104779330|ref|YP_605828.1| glycyl-tRNA synthetase subunit beta [Pseudomonas entomophila L48]
 gi|166227918|sp|Q1IH28|SYGB_PSEE4 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|95108317|emb|CAK13011.1| glycyl-tRNA synthetase, beta chain [Pseudomonas entomophila L48]
          Length = 684

 Score =  620 bits (1600), Expect = e-175,   Method: Composition-based stats.
 Identities = 206/725 (28%), Positives = 340/725 (46%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y + + Y  P RL + L+ 
Sbjct: 1   MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTSKQVYAAPRRLAVLLRQ 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L    P++     GP         G   +A  GF +  G++     Q       G     
Sbjct: 61  LDVQQPDRSINIDGPPRQAAFDAEGNPTQAALGFAKKCGVELSDIDQS------GPKLRF 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
               P +    +L TIV  ++  +P PK M W  +        ++RP + ++ +L     
Sbjct: 115 SQHIPGKATASLLPTIVEDSLNDLPIPKRMHWGASRE-----EFVRPTQWLVMLL----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  + + +  +Y+ DL +A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQKAGRESRGHRFHHPENVVITTPANYVEDLRKAYVLADFAERRELISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 TAELAMQQEGSAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+N+++ D    IV+GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDSEGKLLPRFITVANVESRD-PKQIVEGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      +PL+    RL   +VVF A++GT  ++  R+  L   IA  I    A  
Sbjct: 334 ----------KQPLESFNERLK--NVVFQAQLGTVFDKAERVSKLAAFIAPYIGGSAANA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA+   E      A+ E   PRG    +P  
Sbjct: 382 GRAGLLSKCDLASEMVGEFPEMQGIAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTTAVEF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  I      ++   +  + L     ++ 
Sbjct: 502 AVKQFGTKVKAAGLSEQVLEFIFDRLRARYEDEGIDVATYLSVRALKPGSALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +      + KR+  +L    K    I+ ++ P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPEANALAAANKRVSNLL---GKAEGAIADQVEPKYFDNANEFSLYSAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y++    L ++ +P++ FF+ VLVN +D +VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMASARQYNEALARLAALRDPVDAFFEAVLVNAEDAKVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|209964965|ref|YP_002297880.1| glycyl-tRNA synthetase, beta subunit GlyS [Rhodospirillum centenum
           SW]
 gi|238064854|sp|B6INH0|SYGB_RHOCS RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|209958431|gb|ACI99067.1| glycyl-tRNA synthetase, beta subunit GlyS [Rhodospirillum centenum
           SW]
          Length = 714

 Score =  620 bits (1600), Expect = e-175,   Method: Composition-based stats.
 Identities = 267/740 (36%), Positives = 394/740 (53%), Gaps = 67/740 (9%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M + L+E++ EEIPARMQ +A ED   ++   L   G+ +Q    + TP R+ L ++G+ 
Sbjct: 1   MAELLIELFMEEIPARMQVRAGEDFRRLVTDRLAAAGIQFQRAEVHTTPRRIALVVEGIP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               +  EER GPRVG+ ++A+ GFLR+ GL  IS  + ++D  KG  Y AV+ KP    
Sbjct: 61  ARQADVREERKGPRVGSPEQALQGFLRAAGLTDISQAE-QRDTGKGVFYFAVIEKPGGAT 119

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D L  ++  AI+ +PWPKSMRW T       F W+RPL  IL +   +     +     
Sbjct: 120 IDALPALIDGAIRDLPWPKSMRWGTNQ-----FRWVRPLHGILALFDGQVVPGGLTIGTA 174

Query: 181 KE-------------------IPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDP 221
           +                    I  GN T GHRF +P  + V S + Y   L  A V+LD 
Sbjct: 175 EPPPETSEGNACLAGEATARVIRYGNETKGHRFLSPDTLTVTSFEDYKAKLRGAHVILDR 234

Query: 222 ECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRL 281
           E R+  IL  A   A A GL L +D  LLEE+ GLVEW  V +G  D++++ +P E++  
Sbjct: 235 EERKQLILAGARAAAEAEGLVLKDDPGLLEEVAGLVEWPVVLVGGIDEQFMDVPAEVLTT 294

Query: 282 TIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQ 341
           +++T+Q+ F   T +G LA  F++V+N    DGGAA+V GN RV+ ARL DA  FW +D 
Sbjct: 295 SMRTHQRYFALETTQGKLAPRFVVVANRPTVDGGAAVVAGNERVLRARLSDAKFFWDQD- 353

Query: 342 NNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIA 401
                              L+ PL+ R   L   D+ FH K+GT  ER  RI  L  +IA
Sbjct: 354 -------------------LATPLETRRQAL--ADIKFHEKLGTMLERAERIEALAVEIA 392

Query: 402 QLIDADVALVDR---AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEH 458
           + +  D   ++R   A  L KADL T +V EFPE+QG +G   A  Q+      DAI +H
Sbjct: 393 RTLGLDTGALERVRIAARLCKADLVTGVVGEFPEVQGILGGHVARAQDLPADVADAIADH 452

Query: 459 LKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILE 518
            +P GP + VP + +++ V+LADK+DTL+ F+AI+EKP+GS+DP+ALRRA LG+IR+I+E
Sbjct: 453 YRPLGPSDRVPADPVAVAVALADKIDTLVAFFAIDEKPTGSRDPFALRRAALGVIRLIVE 512

Query: 519 NKIDIPLSQFIEDQ--------------NLILFFHDRLKLYLHDRDIRHDLIEAILRP-E 563
           N +   L                     +L+ FF DRLK+ L ++ +RHDLI+A+     
Sbjct: 513 NGLRASLLPLFGRAAVAVPAAAGETVGGDLLSFFADRLKVALKEKGVRHDLIDAVFGLGG 572

Query: 564 NDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNRE--ISLEISPQYLLL 621
            D+L+ ++  +  L  F +S  G   L++ +R   IL IEEKK+        I    L  
Sbjct: 573 QDDLVLLLKRVDALAGFVASEDGANLLVAYRRAANILRIEEKKDGVSYSGGGIDAGRLEQ 632

Query: 622 EAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNR 681
             E+ L A +      +   +  + +     LL ++  P++ FFD+V VN  D  +R NR
Sbjct: 633 AEERALAAALDATAADLAPLLAAEDFTGAMRLLSALRGPVDAFFDKVTVNAPDAVLRANR 692

Query: 682 LSLLQYIKNIILIVINVQKI 701
           L LL  I++ +  V +  +I
Sbjct: 693 LRLLARIRDTLNGVADFSRI 712


>gi|269103825|ref|ZP_06156522.1| glycyl-tRNA synthetase beta chain [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163723|gb|EEZ42219.1| glycyl-tRNA synthetase beta chain [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 689

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 215/722 (29%), Positives = 345/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+E+ +EE+P +     AE  +      LK   + +  +  +  P RL L +  L+ +
Sbjct: 5   NFLIELGTEELPPKALRTLAEAFAANFEAELKAADLAHNGIEWFAAPRRLALKVNALAEN 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
            P+KI E+ GP +       G   KA  G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QPDKIVEKRGPAIASAFDADGNPTKAAQGWARGNGITVEQAERLVTD--KGEWLLFKQEV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +   A+ K+P PK MRW    +      +IRP+K++  +L      +++
Sbjct: 123 KGQEAKALLPELATNALAKLPIPKPMRWGDKET-----QFIRPVKTLTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           ++  +  +       GHRF       + + D Y   LE    V+ D E R+  I+ DA +
Sbjct: 173 VEGTILGVDSARTIRGHRFMGESEFTIDNADQYPAILEERGKVMADYEARKAIIVADAQK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  VG     D +L+EE+  LVEW  V   SF++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQEVGGIADLDDELVEEVTSLVEWPVVLTASFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            EG L   FI VSN+ + D  + I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 AEGNLVPKFIFVSNLISKD-PSQIIAGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   +PL  R+ +L+    +F  K+GT  ++  RI  L   IA  IDADV    RA
Sbjct: 339 -------KRPLIDRLPQLETA--IFQQKLGTIKDKTDRITELAGFIAAKIDADVDNAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E   PR   + +P+  +S
Sbjct: 390 GLLSKCDLMTSMVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYMPRFAGDELPSTGVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADKLDTL+  + I + P GS DP+ALRRA LG++RII+E   ++ L + +     
Sbjct: 450 AAVAMADKLDTLVGIFGIGQAPKGS-DPFALRRAALGVLRIIVEKGYNLDLVELVAKAHE 508

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        ++I F   R + +  D     D+I+A+L             +K ++ 
Sbjct: 509 LYGDKLSNDNVESDVIEFMLGRFRAWYQDEGFSVDVIQAVLALHPTKPADFDQRVKAVSH 568

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F      E    + KR+  ILA   K + E+  +     L+ +AEK L A I+     ++
Sbjct: 569 FRELDAAESLAAANKRVGNILA---KFDGELPAQWDNALLVEDAEKTLAADIAAMQATLE 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
            +     Y Q    L S+ EP++ FFD V+V  DD +++ NRL++L  ++N+ L V ++ 
Sbjct: 626 PAFAAGNYQQALTELASLREPVDAFFDNVMVMADDEKLKVNRLTMLNALRNMFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|238765095|ref|ZP_04626030.1| Glycyl-tRNA synthetase beta subunit [Yersinia kristensenii ATCC
           33638]
 gi|238696712|gb|EEP89494.1| Glycyl-tRNA synthetase beta subunit [Yersinia kristensenii ATCC
           33638]
          Length = 689

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 203/722 (28%), Positives = 328/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDSANLPHGEVIWYAAPRRLALKVINLSAS 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLITD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVSTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGSE-----V 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    I  GHRF       + + D Y +  LE   V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSDRIIRGHRFMGESEFALDNADQYPQVLLERGKVIADYELRKAIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 TAGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNTKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDTLNDHVHASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FFD V+V  ++  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETVDEFFDSVMVMDENDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|118581462|ref|YP_902712.1| glycyl-tRNA synthetase subunit beta [Pelobacter propionicus DSM
           2379]
 gi|118504172|gb|ABL00655.1| glycyl-tRNA synthetase beta chain [Pelobacter propionicus DSM 2379]
          Length = 687

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 209/725 (28%), Positives = 344/725 (47%), Gaps = 67/725 (9%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
            +  LEI +EEIPA    +A  ++  ++   L    + Y  ++   TP RL L +K +  
Sbjct: 4   KELFLEIGTEEIPAGFIPRAMAEMEAMITRELTNARLSYSTVQTMATPRRLALVVKDIPA 63

Query: 62  HSPEKIEERLGP-------RVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
             P+      GP         G   KA +GF R  G+       +     KG+       
Sbjct: 64  VQPDAEITATGPSKKAAFDADGKPTKAAEGFARGQGVTVDQLQIV--TTDKGEYLAVTKT 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
           +  R   ++L  I+P  I  +P+ KSMRW           + RP+  I+ +         
Sbjct: 122 ETGRPTPELLSEILPAMIASIPFKKSMRWGDLD-----VRFARPIHWIVALFDGI----- 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHR 234
           ++      I  G+++ GHRF A     V++  HY+ + E   V++DPE R+  I  ++HR
Sbjct: 172 VVPFVFGNIESGSVSRGHRFMANTSFPVRNFSHYLDECERHFVIVDPERRKELIRRESHR 231

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
           +A+A G  L+ D++LLE+I  LVE+     G+F +++L +P+E++  +++++Q+ F    
Sbjct: 232 VAAAAGGHLLPDEELLEQITYLVEYPSAVHGTFSREFLKVPKEVLITSMRSHQRYFSIVD 291

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            +G L   FI ++N    D    +V+GN RV+ ARL DA  F++ DQ             
Sbjct: 292 GQGNLMPGFITINNTLTDD-PGVVVKGNERVLRARLSDARFFFEEDQ------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLID-ADVALVDR 413
                     LD+R+  L    VV+  K+GT  E++ R R L +++A  ++ A  +   R
Sbjct: 338 -------KVKLDERVEELK--KVVYQQKLGTSFEKMERFRALAEELADRLNPAVKSETSR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A  L KADL + +V EFPE+QG +G+EYA+L+ E+     AI EH  P      +P + I
Sbjct: 389 AAWLCKADLVSGMVGEFPEVQGIMGREYALLEGESGDVACAIAEHYLPIQAGGELPASDI 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
              VS+ADKLDT+   +++   P+G+ DPYALRRAT+GII IIL+    + L+  I+   
Sbjct: 449 GAFVSIADKLDTICGCFSVGLIPTGAADPYALRRATIGIIAIILDRGYRLGLASLIDRSL 508

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                            ++ FF  R    L       D +EA +  E D+L+ +   +  
Sbjct: 509 DLLEAKLLRPKEQVATEVLEFFRGRFVNLLGGE-FDADAVEAAVSAEFDDLVDVKSRVAA 567

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           L +F S    E   ++ KRI  I+             + P      AE  LY    +   
Sbjct: 568 LAQFKSHPDFEPLAVAFKRIGNIIK------GGTDALVDPSLFQDAAEGALYQAFHEVKV 621

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
           H+   ++   +      +  +  P++ FFD+V+V  +D+ VR NRL+LL  I  +   + 
Sbjct: 622 HVSALVEQGAWQDALTRIAGLRAPVDGFFDKVMVMAEDQRVRSNRLALLTAIDRMFGRIA 681

Query: 697 NVQKI 701
           +  +I
Sbjct: 682 DFSRI 686


>gi|95929742|ref|ZP_01312483.1| Glycine--tRNA ligase [Desulfuromonas acetoxidans DSM 684]
 gi|95134038|gb|EAT15696.1| Glycine--tRNA ligase [Desulfuromonas acetoxidans DSM 684]
          Length = 688

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 205/727 (28%), Positives = 338/727 (46%), Gaps = 67/727 (9%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +  LEI +EEIPA M   A  DL  ++   L    V + ++  Y TP RL L +  +
Sbjct: 1   MAKELFLEIGTEEIPAGMLPVAMRDLERMMRKELTNARVAFGDVTTYATPRRLVLSVADV 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           +     +     GP V       G   KA  GF RS G+        +++ +KG      
Sbjct: 61  AEEQERQELNLSGPSVKVAFDADGNPTKAALGFARSNGVDVSE--LTQQETEKGTYLFLS 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
                + I++ L  I+   +  + + KSMRW           + RP+  ++ +   E   
Sbjct: 119 KVIEGQPIKEQLPEIMERIVSSLSFKKSMRWKDLD-----VRFARPVHWLIALFGGE--- 170

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
             +I      +  GN +YGHRF AP    V  LD ++    E  V++DPE R+  I  + 
Sbjct: 171 --VIPFSWGNLTSGNTSYGHRFMAPAGFDVTGLDDFVAKAREHFVIVDPEERKQIIAREI 228

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
            R+A   G  L  D+DLLEE+  LVE      GSF++++L LP+EL+  ++K +Q+ F  
Sbjct: 229 ERVAGEEGGALNVDEDLLEEVAYLVEDPTPLCGSFEEEFLQLPDELLITSMKEHQRYFTL 288

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              EG L   FI +SN + +D    +V+GN RV+ ARL DA+ FWK DQ           
Sbjct: 289 ADTEGRLLPKFITISNTRPTD-PDVVVKGNERVLRARLSDAMFFWKEDQ----------- 336

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADV-ALV 411
                      PL+ R+  L   +VV+ A++GT   +V R   L + +A   D++V  L 
Sbjct: 337 ---------KTPLENRLEALK--NVVYQAQLGTSYAKVQRFTALAEDLASQFDSEVVELT 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA  L K DL T +V EFPELQG +G+EYA ++ E+     AI EH  P     ++P++
Sbjct: 386 RRAAQLCKCDLETGMVYEFPELQGVMGREYAAIEGEDPRVAKAIFEHYLPVQAGGDLPSD 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
            +   VS+ADK+DT+   + +   P+G+ DPYALRR  +G++ I+L+    + + + +  
Sbjct: 446 NVGAFVSIADKIDTICGCFGVGLIPTGTADPYALRRCAIGVLNILLDRGFTVSIPELVAK 505

Query: 532 Q-----------------NLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLI 574
                             +++ F   R    +   +   D++EA+L    DN++     I
Sbjct: 506 AVKQLEDKLNRSVEEVTADVVEFIRLRFVNMMTGPETATDVVEAVLAARFDNVMDARQRI 565

Query: 575 KHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDF 634
           + L+      + E    + KR+  I+         ++  +  +    + E+ +Y  +   
Sbjct: 566 EALSAMKQQPEFEALAATFKRVGNIIK------GGVTDAVDAECFEQDCEREMYGALQQV 619

Query: 635 GTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILI 694
              +   M    Y      + S+   ++ FFD V+V  +D  V+ NRL+LL  +  +   
Sbjct: 620 QQDVARLMADGDYPGALRAIGSLRPAVDAFFDGVMVMAEDEAVKRNRLALLTQVAGLFAG 679

Query: 695 VINVQKI 701
           + +  +I
Sbjct: 680 LADFSRI 686


>gi|146305055|ref|YP_001185520.1| glycyl-tRNA synthetase subunit beta [Pseudomonas mendocina ymp]
 gi|166227919|sp|A4XN72|SYGB_PSEMY RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|145573256|gb|ABP82788.1| glycyl-tRNA synthetase beta chain [Pseudomonas mendocina ymp]
          Length = 684

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 210/723 (29%), Positives = 342/723 (47%), Gaps = 66/723 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   LK  G+ Y   R Y  P RL + ++ 
Sbjct: 1   MSAKDFLVELGTEELPPKALKSLGDAFLAGIEKGLKAAGLNYAASRVYAAPRRLAVLVEQ 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L     ++     GP +       G   +A  GF R  G+       I +  + G     
Sbjct: 61  LEEQQADRSMNLDGPPIQAAFDADGNPTQAALGFARKCGVD------IAEIDRSGAKLRF 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
               P +   ++L TIV  ++  +P PK MRW+          ++RP + ++ +      
Sbjct: 115 AQHIPGQPAVNLLPTIVQDSLNDLPIPKRMRWAARRD-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            + ++D ++     G ++ GHRFHA   +++ S  +Y  DL  A VL D   RR  I   
Sbjct: 165 GDAVVDCEILAQKAGRVSRGHRFHANREVRISSPANYAEDLRSAYVLADFAERREIISRR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+A     +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELAAAEQGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALISTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
                G L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAGGKLLPRFITVANIESKD-PAQIVSGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA+ +  D A  
Sbjct: 334 ----------KQKLEGFNQRL--ANVVFQAQLGSVFDKAQRVSALAGFIAREVGGDEARA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P+ 
Sbjct: 382 ARAGLLSKCDLATEMVGEFPEMQGIAGYYYALNDGEPQDVALALNEQYMPRGAGAELPST 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E  +D+ L+  ++ 
Sbjct: 442 LTGAAVAVADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKGLDLDLAAAVDF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                            ++ F  DRL+    D  I   + +A+      + L     ++ 
Sbjct: 502 AVAQYAGKVKSDGLAAQVLEFIFDRLRARYEDEGIEVAVYQAVRAVNPTSPLDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    + E    + KR+  +L+  E     ++ ++   Y    +E  L+A I     
Sbjct: 562 VQAFRKLPQAEALAAANKRVSNLLSKAE---GGVAAQVEAHYFDNPSEFALHAAIQQADQ 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y++    L S+ EP++ FF+ VLVN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPLAAARQYNEALAKLASLREPVDAFFEAVLVNAEDARVRANRYALLARLRGLFLGVA 678

Query: 697 NVQ 699
           ++ 
Sbjct: 679 DIS 681


>gi|90019661|ref|YP_525488.1| glycine--tRNA ligase [Saccharophagus degradans 2-40]
 gi|89949261|gb|ABD79276.1| Glycyl-tRNA synthetase, beta subunit [Saccharophagus degradans
           2-40]
          Length = 690

 Score =  620 bits (1599), Expect = e-175,   Method: Composition-based stats.
 Identities = 208/724 (28%), Positives = 345/724 (47%), Gaps = 61/724 (8%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  +FL+E+ +EE+P       +   +  +   L    + Y  +  Y TP RL +++K L
Sbjct: 1   MSYEFLVELGTEELPPTALKTLSNAFTQGICNGLDSAKLSYSAVESYATPRRLAVWVKDL 60

Query: 60  SPHSPEKIEERLGPRV------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVL 113
           +  +P +  +  GP        GA  KA + F +  G++        ++  K D  +   
Sbjct: 61  AQSTPVEDLKVWGPPAAIAFKDGAPTKAAEAFAKKNGVEVSELAT--ENDGKADKLVVNA 118

Query: 114 RKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKE 173
           +       D+L+ IV  ++  +P  K MRW       S   ++RP+   + +L      +
Sbjct: 119 KAGGEAAADLLEGIVNASLAALPISKRMRWGA-----SRAEFVRPVHWAIMLL-----ND 168

Query: 174 KIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYI-RDLEEAMVLLDPECRRNAILNDA 232
            ++   L     GN+T GHRFHA   I +Q+   Y    LE+  V+   E RR  I    
Sbjct: 169 DVLPATLLGKATGNVTRGHRFHANTDITIQNAQSYASTLLEQGKVVASFEDRRATIAKQV 228

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
              A ++G E V   DLL+E+  LVEW     G FD+ +L +P E +  ++K +QK F  
Sbjct: 229 AEQAKSLGGEAVISDDLLDEVSALVEWPVALGGRFDESFLSVPAEALISSMKEHQKYFHV 288

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              +G L   FI VSNI+++D  A ++ GN RV+  RL DA  F++ D+           
Sbjct: 289 VDSKGALLPYFITVSNIESTD-PAQVIDGNERVIRPRLADAAFFFETDK----------- 336

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD 412
                       L+ R  +L    VVF AK+GT  ++  RI  L + IA  +  D +   
Sbjct: 337 ---------KSSLEARREKLK--SVVFQAKLGTIYDKTQRITGLSQHIADKLSIDASNAV 385

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA  L K+DL + +V EFPE+QG  G  YA+   EN +   AI E   P+   + +P + 
Sbjct: 386 RAAQLCKSDLVSNMVYEFPEMQGIAGYSYALNDGENETVAQAIVEQYMPKFAGDTLPASD 445

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED- 531
               V+LAD+LDT+   + I + P+GSKDP+ALRRA+LG +R+++E   ++ L   I   
Sbjct: 446 EGTIVALADRLDTITGIFGIGQTPTGSKDPFALRRASLGALRLLVEKGYELDLRDLITQA 505

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHL 577
                         ++++ +  +R K +  + +I  ++ +A+   +    L I + +  +
Sbjct: 506 AGQFSDLPKADSVVEDVLAYMLERFKAWYEEANIPSEVFQAVSAKQLSTPLDINNRVYAV 565

Query: 578 NEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTH 637
           N F+S  +      + KR+  ILA   K + E++ E+    L   AE  L   +    T 
Sbjct: 566 NSFYSLPQAAALASANKRVSNILA---KNDAEVAGEVDAALLTEAAEIALAKQVQKMQTA 622

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
           +   +  + Y Q    L  + E ++ FFD V+V  DD  VR+NRL+LL  ++ + L V +
Sbjct: 623 VTPLLAERNYEQALTTLAGLREAVDSFFDDVMVMTDDLAVRNNRLALLSKLRELFLHVAD 682

Query: 698 VQKI 701
           +  +
Sbjct: 683 ISLL 686


>gi|56459117|ref|YP_154398.1| glycyl-tRNA synthetase subunit beta [Idiomarina loihiensis L2TR]
 gi|81821718|sp|Q5QY35|SYGB_IDILO RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|56178127|gb|AAV80849.1| Glycyl-tRNA synthetase, beta subunit [Idiomarina loihiensis L2TR]
          Length = 688

 Score =  620 bits (1598), Expect = e-175,   Method: Composition-based stats.
 Identities = 218/721 (30%), Positives = 369/721 (51%), Gaps = 60/721 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           + L+E+ +EE+P +      + L   +   LK   + + ++  Y TP RL + +K +   
Sbjct: 5   NLLIELGTEELPPKALKSLRDSLKSGIESGLKNAELSFDSIEAYATPRRLAVLVKQVETE 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             +K  E+ GP +       G   KA +G+ RS G+      ++K D  KG+  L     
Sbjct: 65  QQDKEVEKRGPAINVAFDDTGKPTKAAEGWARSNGITVEQADRLKTD--KGEWLLHKATV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             + +  +++ I+  AI+ +P PK MRW       S   +IRP+ ++  +L +E     +
Sbjct: 123 KGQALSVLVQGILEAAIKALPIPKPMRWGD-----STAQFIRPVHTLTVMLGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRL 235
           ID ++ E        GHRFH+P   ++  +D+Y+  L EA V+ + E R   I ++  RL
Sbjct: 173 IDAEILETKSARFIQGHRFHSPQGFELDHVDNYLFKLREAKVIANFEERIETIQSEVSRL 232

Query: 236 ASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTR 295
           AS +G ++++D +L+EE+  LVEW      SFD+ +L +P+E + +T+K +Q+ F     
Sbjct: 233 ASELGGQVIQDDELVEEVAALVEWPVALTASFDQGFLAVPKEPLIVTMKDDQRYFPVEDG 292

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
           +G L   FI ++NI++ D    I++GN +VV  RL DA  F++ D+              
Sbjct: 293 KGNLLPQFIFITNIESRD-PQQIIKGNEKVVRPRLADAQFFFESDK-------------- 337

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAI 415
                    L+ R+A LD   V+F  ++G+ G++  RI VL  KIA  + ADV   +RA 
Sbjct: 338 ------KVTLESRVAALD--SVLFQKQLGSIGDKARRISVLAGKIANQLTADVKASERAG 389

Query: 416 VLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISI 475
           +L KADL +++V EFPE QG +GK YA+   E+    +AIE+H  PR   + +P  K + 
Sbjct: 390 LLCKADLVSDMVSEFPETQGVMGKHYALNDGESPVVAEAIEQHYWPRFSGDELPLTKEAC 449

Query: 476 TVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIE----- 530
            V+LADKLDTL+  + I + P G +DP+ALRRA LG++R ++E K+ + L + +      
Sbjct: 450 AVALADKLDTLVGIFGIGQVPKGDRDPFALRRAALGLLRTLVERKLSLDLHELLAASVEG 509

Query: 531 ----------DQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEF 580
                       ++  F   R + +  D+ I  D+I+++L             +K +  F
Sbjct: 510 FGDKLSNNTVATDVFDFLLGRFRPWYQDQGITVDVIQSVLARSPSKPTDFDQRVKAVQSF 569

Query: 581 FSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQE 640
            S         + KR+  ILA   K + EIS  +    L  E+E  LY ++      ++ 
Sbjct: 570 KSMDSAASLAAANKRVGNILA---KSDEEISGNVDEALLQEESETTLYRLVKQTEGAVKP 626

Query: 641 SMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQK 700
            +   +Y      L  + EP++ FF+ V+VN DD +VR NRL+LL  ++ + L + ++  
Sbjct: 627 LIAAGKYSDALTHLSELKEPVDAFFEHVMVNADDDKVRINRLNLLFRLRQLFLEIADISL 686

Query: 701 I 701
           +
Sbjct: 687 L 687


>gi|110832869|ref|YP_691728.1| glycyl-tRNA synthetase [Alcanivorax borkumensis SK2]
 gi|110645980|emb|CAL15456.1| glycyl-tRNA synthetase [Alcanivorax borkumensis SK2]
          Length = 690

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 214/726 (29%), Positives = 350/726 (48%), Gaps = 63/726 (8%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  D L+E+ +EE+P +     +  L+   +  L E G+ +  + ++  P RL L ++ L
Sbjct: 1   MSRDLLIELGTEELPPKALASLSAALTDEFVRQLDEAGLNHGAVERFAAPRRLALLVRDL 60

Query: 60  SPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
                ++  ER GP V       G   KA  GF  S GL    D   ++D  KG+  +A 
Sbjct: 61  DEKQADRDIERQGPAVQAAFDSDGNPTKAAQGFAASLGLTV--DQLGRQDTGKGERLVAQ 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
           + +  +   +++      +IQK+P PK MRW           ++RP   ++ +       
Sbjct: 119 ITEQGKSAAELIPAFFTQSIQKLPIPKRMRWGKRK-----VQFVRPAHWLVALF-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDL-EEAMVLLDPECRRNAILND 231
           +++I  +L ++  G  +YGHRFHAP  I++ S   Y + +  +  VL D + R+  I   
Sbjct: 169 DEVIPFELLDLQSGRTSYGHRFHAPGAIELASASEYAQRIENDGHVLADFDRRKAMIKEQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
                   G     + DLL E+  LVEW +  MGSFD  +L +P+E +   ++ +QK F 
Sbjct: 229 TLAAGKEAGGVAQINPDLLNEVTALVEWPEALMGSFDDDFLRVPQEALISAMEEHQKYFS 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI +SNIQ+ D    ++ GN +V+  RL DA  F+  D           
Sbjct: 289 VLDNDGKLMPRFITISNIQSKD-PQQVIHGNEKVIRPRLADAAFFYDND----------- 336

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L Q    L   +VVF  ++GT  E+  RI  L   IA+ I  DV   
Sbjct: 337 ---------CKRTLAQHAEGL--TNVVFQQQLGTVAEKCERIGGLAAVIAENIGGDVDNA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
             A  LSKADL +E+V EF  +QG +G   A  + +     +A+ E   PR   + +P +
Sbjct: 386 KLAGKLSKADLNSEMVGEFDTMQGIMGFYLAQREGQPKEVANALYEQYLPRFAGDTLPQS 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
           K  + VSLADK+DTL+  + I +KPSG+KDPYALRRATLG++RII+E+++ + L + ++ 
Sbjct: 446 KTGMAVSLADKIDTLVGIFGIGQKPSGTKDPYALRRATLGVLRIIIEHELALDLRELLDK 505

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPEN--DNLLTIVDLIK 575
                          +   F   R +    ++ I   +I ++L  ++     L     +K
Sbjct: 506 AAEQLGERIDTAQVDDAFEFIKGRYRAIYQEQGIATPVILSVLAIDDACRKPLDFDRRVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F    + +    + KR+  ILA  E    E   EI    L  EAEK L  ++    
Sbjct: 566 AVAAFQQRDEAQALAAANKRVSNILAKLETAPAE---EIDGALLEDEAEKTLTNMVVAAF 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
               E ++   Y  + ++L  + EP++ FFD V+V  +D  VR+NRL+LL +++++ L V
Sbjct: 623 EQTYELLEAGDYASVLEMLAQLREPVDTFFDTVMVMAEDEAVRNNRLALLAFLRDLFLNV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|253987711|ref|YP_003039067.1| glycyl-tRNA synthetase subunit beta [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779161|emb|CAQ82321.1| glycyl-trna synthetase beta chain (glycine--trna ligase beta chain
           (glyrs) [Photorhabdus asymbiotica]
          Length = 689

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 201/722 (27%), Positives = 333/722 (46%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  + TP RL L +  L   
Sbjct: 5   TFLVEIGTEELPPKALRSLAEAFAANFAAELDNANLAHGEVSWFATPRRLALKVANLDEA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITAAQAERLVTD--KGEWLLYRALV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
               ++++L  +V  A+ K+P PK MRWS   +      ++RP+ ++  +        ++
Sbjct: 123 KGLSVKELLAGMVNNALSKLPIPKLMRWSDKET-----QFVRPVHTVTMLF-----GNEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEE-AMVLLDPECRRNAILNDAHR 234
           I+ D+  I    +  GHRF       + + + Y   L++   V+ D   R+  I  D  +
Sbjct: 173 IEGDILGIKSTRVIRGHRFMGESEFTIDNTEQYPEILQQRGKVMADYVTRKALIKQDVEQ 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAVKLGGIADISDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++SD    I+ GN +VV  RL DA  F+K D+             
Sbjct: 293 HAGKLMANFIFVANIESSD-PQQIISGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   + L+  + RL+   V+F  ++GT  ++  RI+ L   IA+ I ADV    RA
Sbjct: 339 -------KQRLEDNLPRLET--VLFQKQLGTLRDKTDRIQALAGWIAEKIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   + +P+  IS
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYQPRFAGDELPSTGIS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG +RII+E K+ + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKKLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  ++    D I+A+L             +K +  
Sbjct: 510 LYGDKLTNAKVIDDVVEFMLGRFRAWYQEQGYSIDTIQAVLARRPTQPADFDARVKAVTH 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +  +      + KR+  ILA   K    ++ ++S   L    E +L   +      + 
Sbjct: 570 FRTLDEATALAAANKRVSNILA---KSEETLNEKVSASVLKAPEEVKLATHLVVLQDKLA 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y +    L S+ E ++ FFD V+V  +D++VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PLFAEGCYQEALVELASLREVVDAFFDNVMVMDEDQQVRVNRLTLLSELRELFLKVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|325275347|ref|ZP_08141297.1| glycyl-tRNA synthetase subunit beta [Pseudomonas sp. TJI-51]
 gi|324099518|gb|EGB97414.1| glycyl-tRNA synthetase subunit beta [Pseudomonas sp. TJI-51]
          Length = 683

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 208/724 (28%), Positives = 343/724 (47%), Gaps = 65/724 (8%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +      +     +   L+  G+ Y   + Y  P RL + ++ 
Sbjct: 1   MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTGKQVYAAPRRLAVLIRQ 60

Query: 59  LSPHSPEKIEERLGPRV------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
           L    P++     GP +      G   +A  GF +  G+      +I +   K       
Sbjct: 61  LDVQQPDRSINIDGPPLQAAFKDGEPTQAALGFAKKCGV---ELAEIDQSGPK---LRFS 114

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
              P +    +L TIV  ++  +P PK MRW+ +        ++RP + ++ +L      
Sbjct: 115 QHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASRE-----EFVRPTQWLVMLL-----G 164

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDA 232
           ++++D  +        + GHRFH P  + + +  +Y+ DL +A VL D   RR  I    
Sbjct: 165 DQVVDCTILSQKADRESRGHRFHHPENVLITAPANYVEDLRKAYVLADFAERRELISKRT 224

Query: 233 HRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVT 292
             LA       +    LL+E+  LVEW    + SF++++L +P+E +  T++ NQK F  
Sbjct: 225 AELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFCL 284

Query: 293 RTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKE 352
              EG L   FI V+N+++ D    IVQGN +VV  RL DA  F+K+D+           
Sbjct: 285 LDSEGKLLPRFITVANVESRD-PKQIVQGNEKVVRPRLTDAEFFFKQDK----------- 332

Query: 353 SALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVD 412
                     +PL+    RL   +VVF A++GT  ++  R+  L   IA LI  D     
Sbjct: 333 ---------KQPLETFNERLK--NVVFQAQLGTVYDKAERVSKLAAFIAPLIGGDAQRAG 381

Query: 413 RAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNK 472
           RA +LSK DL TE+V EFPE+QG  G  YA+   E      A+ E   PRG    +P   
Sbjct: 382 RAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTL 441

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED- 531
               V++ADKLDTL+  + I   P+GSKDPYALRRA LG++RI++E ++D+ L+  +E  
Sbjct: 442 TGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLNLTGAVEFA 501

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHL 577
                         + ++ F  DRL+    D  I      ++   +  + L     ++ +
Sbjct: 502 VKQFGAKVKAAGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAV 561

Query: 578 NEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTH 637
             F    + E      KR+  +L+  E     I+ ++ P+Y     E  LY+ I      
Sbjct: 562 QAFRKLPEAEALAAVNKRVSNLLSKAE---GAIAEQVEPKYFDNANEFSLYSAIQQADQA 618

Query: 638 IQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVIN 697
           +Q     ++Y +    L ++ +P++ FF+ V+VN +D +VR NR +LL  ++ + L V +
Sbjct: 619 VQPMAAARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVAD 678

Query: 698 VQKI 701
           +  +
Sbjct: 679 ISLL 682


>gi|320326674|gb|EFW82719.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331351|gb|EFW87294.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 684

 Score =  619 bits (1597), Expect = e-175,   Method: Composition-based stats.
 Identities = 207/725 (28%), Positives = 333/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +  + +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTKSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAEGKLLPRFITVANIESKD-PAQIVTGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGAKIKPAGLAEQVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|254428435|ref|ZP_05042142.1| glycyl-tRNA synthetase, beta subunit [Alcanivorax sp. DG881]
 gi|196194604|gb|EDX89563.1| glycyl-tRNA synthetase, beta subunit [Alcanivorax sp. DG881]
          Length = 690

 Score =  619 bits (1596), Expect = e-175,   Method: Composition-based stats.
 Identities = 211/726 (29%), Positives = 347/726 (47%), Gaps = 63/726 (8%)

Query: 1   MP-DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGL 59
           M  D L+E+ +EE+P +     +  L+   +  L E G+ + N+ ++  P RL L ++ L
Sbjct: 1   MSRDLLIELGTEELPPKALASLSAALTDEFVRQLDEAGLNHGNVERFAAPRRLALLVRDL 60

Query: 60  SPHSPEKIEERLGPRVG-------AGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAV 112
                ++  ER GP V           KA  GF  S GL    D   ++D  KG+  +A 
Sbjct: 61  DEKQADRDIERQGPAVQAAFDSDRNPTKAAQGFAASLGLTV--DQLGRQDTGKGERLVAQ 118

Query: 113 LRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAK 172
           + +  +   +++      AIQK+P PK MRW           ++RP   ++ +       
Sbjct: 119 ITEKGKSAAELVPAFFTQAIQKLPIPKRMRWGKRK-----VQFVRPAHWLVALF-----G 168

Query: 173 EKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDL-EEAMVLLDPECRRNAILND 231
           +++I  +L ++  G  +YGHRFHAP  I + +   Y + + ++  VL D + R+  I   
Sbjct: 169 DEVIPFELLDLQSGRTSYGHRFHAPGAIDLATAGEYAQRIEQDGHVLADFDRRKAMIEEQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
                   G     D DLL E+  LVEW +  MGSFD  +L +P+E +   ++ +QK F 
Sbjct: 229 TLAAGKKAGGVAQIDPDLLNEVTALVEWPEALMGSFDDDFLRVPQEALISAMEEHQKYFS 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI +SNIQ+ D    ++ GN +V+  RL DA  F+  D           
Sbjct: 289 VLDADGKLMPRFITISNIQSKD-PQQVIHGNEKVIRPRLADAAFFYDND----------- 336

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L Q    L   +VVF  ++GT  ++  RI  L   IA  I  +    
Sbjct: 337 ---------CKRTLAQHAEGL--ANVVFQQQLGTVADKCQRIGSLAAVIAGQIGGNADNA 385

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
             A  LSKADL +E+V EF  +QG +G   A  + +      A+ E   PR   + +P +
Sbjct: 386 KLAGELSKADLNSEMVGEFDTMQGIMGFYLAQREGQPDDVAKALYEQYLPRFAGDTLPQS 445

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
           K  + VSLADK+DTL+  + I +KPSG+KDPYALRRATLG++RII+EN++ + L + ++ 
Sbjct: 446 KTGMAVSLADKIDTLVGIFGIGQKPSGTKDPYALRRATLGVLRIIIENELALDLRELLDQ 505

Query: 532 --------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPEN--DNLLTIVDLIK 575
                         ++   F   R +    ++ I   +I ++L  +      L     +K
Sbjct: 506 AAAQLGERIDANQVEDAFDFIKGRYRAIYQEQGIATPVILSVLAIDEACRKPLDFDRRVK 565

Query: 576 HLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFG 635
            +  F    + +    + KR+  ILA   K +     EI    L  EAE+ L  ++    
Sbjct: 566 AVAAFQQREEAQALAAANKRVSNILA---KLDSAPPEEIDGALLEDEAEQTLTNMVVAAF 622

Query: 636 THIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIV 695
               E ++   Y  + ++L  + EP++ FFD V+V  +D  VR+NRL+LL +++++ L V
Sbjct: 623 EQSYELLEAGDYASVLEMLADLREPVDAFFDTVMVMAEDEAVRNNRLALLAFLRDLFLNV 682

Query: 696 INVQKI 701
            ++  +
Sbjct: 683 ADISLL 688


>gi|71736576|ref|YP_272325.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257485592|ref|ZP_05639633.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298484619|ref|ZP_07002723.1| Glycyl-tRNA synthetase beta chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|123734064|sp|Q48QJ1|SYGB_PSE14 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|71557129|gb|AAZ36340.1| glycyl-tRNA synthetase, beta subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298160843|gb|EFI01860.1| Glycyl-tRNA synthetase beta chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|331011880|gb|EGH91936.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 684

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 207/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAEGKLLPRFITVANIESKD-PAQIVAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGAKIKPAGLAEQVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|302391468|ref|YP_003827288.1| glycyl-tRNA synthetase beta chain [Acetohalobium arabaticum DSM
           5501]
 gi|302203545|gb|ADL12223.1| glycyl-tRNA synthetase beta chain [Acetohalobium arabaticum DSM
           5501]
          Length = 694

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 219/733 (29%), Positives = 358/733 (48%), Gaps = 72/733 (9%)

Query: 1   MPD--FLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M +   LLEI +EEIPA       E L  +   L K+  +   ++  Y TP RL L +  
Sbjct: 1   MSNNKLLLEIGTEEIPAGFMEPTFEQLEELAAELFKQYRIETGSVATYGTPRRLTLVVNE 60

Query: 59  LSPHSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           +S    +  +E  GP         G   KA  GF R  GL         +D   G+   A
Sbjct: 61  VSSRQDDLTKEVKGPAKNIAFDDEGNPTKAGSGFARGQGLTVDELEI--RDTDNGEYLFA 118

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
           V  +  +  E++L  I+   I  + + KSMRW+          ++RP+  IL +      
Sbjct: 119 VQTEEGKPTEELLPEILTELIHDLDFAKSMRWADKD-----MQFVRPIHWILALY----- 168

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++ ++L++ +I     T GHRF +   I++ S   Y   L E  V++D   RR  I++ 
Sbjct: 169 GDEPVELEVADIESDTYTKGHRFLSTGQIEIDSAQDYFDRLNEEYVIVDQNKRREMIIDQ 228

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              L    G E++ D+DLL+E+  LVE+    MGSFD+++L LP E++  +++ +Q+ F 
Sbjct: 229 ITELGKEAGGEVLIDEDLLKEVNYLVEYPTALMGSFDEEFLDLPREVLITSMREHQRYFP 288

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
                G L   FI V N  + D    + +GN +V+ ARL D + F++ DQ          
Sbjct: 289 IEDDNGDLMARFITVRNG-SEDHIDIVREGNEKVLRARLADGMFFYEEDQ---------- 337

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDA---DV 408
                      + L+ ++  L   +V+F   +GT  E+V R+  L K  A+ +D    +V
Sbjct: 338 ----------KEDLEDKVDELK--NVIFQEDLGTIYEKVKRLVELSKVFAKKLDLSEKEV 385

Query: 409 ALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENV 468
               RA  LSKADL TE+V EFP+L+G +G+EYA L  EN +  DAI EH  PR   + +
Sbjct: 386 KDSKRAAYLSKADLITEMVIEFPKLEGVMGREYAKLSGENKAVADAIFEHYLPRYATDVL 445

Query: 469 PTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQF 528
           P  K    VS+ADK+D ++  + +   P+GS+DPYALRR   GI++IIL++ + + L+  
Sbjct: 446 PQTKTGQIVSIADKIDNIVGCFGVGLIPTGSQDPYALRRQAQGIVKIILDSDLKLNLAGL 505

Query: 529 IED-------------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLT 569
           I++                     ++ FF  RL+    +R +R+D+  A+L  +  +L  
Sbjct: 506 IDNVLELLVEAEKLKRSQGEVKTEVLDFFKQRLEHIFEERGVRYDVSNAVLATDITDLND 565

Query: 570 IVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYA 629
            V   + + EF +  K E  L +  R   +           S +I+P     E+E++LY 
Sbjct: 566 AVKRAEAVMEFRNEEKFEDLLTAYNRAGNLADKA------TSEDINPDLFTDESEEKLYE 619

Query: 630 VISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIK 689
                   ++E +  K Y    D L ++ +P++ FF+ V+V  DD +V++NRL+LL+   
Sbjct: 620 AYQSTQAEVEELLVAKDYSSALDELATLQKPVDKFFNSVMVMADDEKVKNNRLALLKNTV 679

Query: 690 NIILIVINVQKIV 702
            I   + ++ +IV
Sbjct: 680 QIFTKIADLSEIV 692


>gi|300719083|ref|YP_003743886.1| glycyl-tRNA synthetase beta subunit [Erwinia billingiae Eb661]
 gi|299064919|emb|CAX62039.1| Glycyl-tRNA synthetase beta subunit [Erwinia billingiae Eb661]
          Length = 689

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 204/723 (28%), Positives = 330/723 (45%), Gaps = 61/723 (8%)

Query: 2   PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP 61
             FL+EI +EE+P +     AE  +      L   G+ +  +  Y  P RL L +  LS 
Sbjct: 4   KTFLVEIGTEELPPKALRNLAESFAAHFTAELDTAGLTHGAVSWYAAPRRLALKVANLSA 63

Query: 62  HSPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLR 114
             P++  E+ GP +       G   KA +G+ R  G+      ++     KG+  L   +
Sbjct: 64  AQPDREVEKRGPAIAAAFDANGVATKAAEGWARGCGITVDQAERL--STDKGEWLLYRAQ 121

Query: 115 KPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEK 174
                 + +L  +V  ++ K+P PK MRW  +        ++RP+ ++  +L      ++
Sbjct: 122 VTGESAQSLLPAMVSTSLAKLPIPKLMRWGDSD-----VQFVRPVHTVTLLL-----GDE 171

Query: 175 IIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAH 233
            +   +  +  G    GHRF       + + D Y +  LE   V  D E R+  I  DA 
Sbjct: 172 SLPATILGVASGRTIRGHRFMGEPEFTIDNADQYPQILLERGKVQADYEVRKAQIKADAE 231

Query: 234 RLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR 293
             A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F   
Sbjct: 232 AAAREIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVY 291

Query: 294 TREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKES 353
              G L   FI V+NI + D    I+ GN +VV  RL DA  F+  D+            
Sbjct: 292 DTAGKLLPNFIFVTNIVSKD-PQQIISGNEKVVRPRLADAEFFFNSDR------------ 338

Query: 354 ALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDR 413
                    K L+  + RL+   V+F  ++GT  ++  RI+ L   IA  I ADV    R
Sbjct: 339 --------KKRLEDNLPRLET--VLFQKELGTLRDKTDRIQALAGWIAGQIGADVNHATR 388

Query: 414 AIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKI 473
           A +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N +
Sbjct: 389 AGLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPV 448

Query: 474 SITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED-- 531
           +  +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+  
Sbjct: 449 ACALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAV 508

Query: 532 -------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLN 578
                          +I F   R + +  +     D I+A+L             +K ++
Sbjct: 509 RLYGSKLSNGKVVDEVIDFMLGRFRTWYQEEGHSVDTIQAVLARRPTRPADFNARMKAVS 568

Query: 579 EFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHI 638
            F +  +      + KR+  ILA   K    ++  +S   L    E +L   +S   + +
Sbjct: 569 HFRTLEEAATLAAANKRVSNILA---KATEPLNDSVSASLLKENEEIQLATYVSALTSKL 625

Query: 639 QESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINV 698
           Q      RY      L  +   ++ FF++V+VN ++REVR NRL+LL  ++ + L V ++
Sbjct: 626 QPYFAEGRYQDALIELAQLRTAVDNFFEKVMVNAEEREVRINRLTLLAKLRELFLQVADI 685

Query: 699 QKI 701
             +
Sbjct: 686 SLL 688


>gi|238787798|ref|ZP_04631595.1| Glycyl-tRNA synthetase beta subunit [Yersinia frederiksenii ATCC
           33641]
 gi|238724141|gb|EEQ15784.1| Glycyl-tRNA synthetase beta subunit [Yersinia frederiksenii ATCC
           33641]
          Length = 689

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 203/722 (28%), Positives = 328/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL L +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDNANLPHGEVIWYAAPRRLALKVINLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVEQAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIR-DLEEAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       +   D Y +  LE   V+ D E R++ I  DA  
Sbjct: 173 IPGTVLGIDSDRVIRGHRFMGEAEFTLDHADQYPQVLLERGKVIADYELRKSIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D+             
Sbjct: 293 TAGNLLPNFIFVANIESKD-PQQIISGNEKVVRPRLADAEFFFNTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 339 -------KKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGAKLTNAKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K    ++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAAALAAANKRVSNILA---KSTDTLNDHVHASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E I+ FF+ V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETIDEFFESVMVMAEDDAVRINRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|237801654|ref|ZP_04590115.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331024513|gb|EGI04569.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 684

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 207/725 (28%), Positives = 333/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     AE     +   L+  G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLAEAFLAGIEKGLQGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LSTQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLNEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTMSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPEDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 IEELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLDVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI V+NI++ D  A I+ GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDVDGKLLPRFITVANIESKD-PAQIIAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVYDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGFYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L   ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVDTVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGTKIKPAGLAEQVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GNIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D +VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|304320092|ref|YP_003853735.1| glycyl-tRNA synthetase subunit beta [Parvularcula bermudensis
           HTCC2503]
 gi|303298995|gb|ADM08594.1| glycyl-tRNA synthetase beta subunit [Parvularcula bermudensis
           HTCC2503]
          Length = 688

 Score =  618 bits (1595), Expect = e-175,   Method: Composition-based stats.
 Identities = 267/717 (37%), Positives = 388/717 (54%), Gaps = 47/717 (6%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M D LLE++SEEIPAR+Q + A DL  ++  LL  E + +     + T  RL L + GL 
Sbjct: 1   MSDLLLELFSEEIPARLQQRGAADLQRLVTDLLSAEALAFDEAVAFATARRLTLRVTGLP 60

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
               ++ EER GPRVGA  KAI+GF+++ GL +I +  +K+D  KG  Y+AV+ +  R  
Sbjct: 61  DAQADRREERKGPRVGAPDKAIEGFMKAAGLASIDEAIVKED-GKGAFYVAVIDQRGRRT 119

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
            D+L   +P  ++  PWPKSMRW  +    +   W+RPL SILC    E     ++   L
Sbjct: 120 ADLLAERLPQLLKTFPWPKSMRWGESE---NELRWVRPLHSILCTFGGE-----VVPFTL 171

Query: 181 KE----IPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLA 236
           +     I  G  T GHRF AP   +  + + Y   L    V+LD   R   I  +A  LA
Sbjct: 172 ENGERPITSGACTAGHRFEAPETFEATTFEDYCETLLARKVILDGARREEKIWAEATALA 231

Query: 237 SAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTR-TR 295
           SA GLE++ D  LL E+ GL EW    MG FD+K+L +P+E +   ++ +QK F  R  +
Sbjct: 232 SAAGLEVIADPGLLAEVSGLAEWPVARMGRFDEKFLAVPDEALIAAMRGHQKYFSVRDPK 291

Query: 296 EGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESAL 355
            G LA  FI V+NI  +DGG A+++G  RV+AARL DA   + +D               
Sbjct: 292 TGRLAPHFICVANIDPADGGQAMMEGYERVLAARLSDAWFLYHQD--------------- 336

Query: 356 KFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAI 415
                L  PL Q   RL   DV +   +GT  E+V R   L +++A  + A  A    A 
Sbjct: 337 -----LKTPLAQHAERLK--DVTYFDGLGTTWEKVGRTADLAERLALALGAAPAAARGAA 389

Query: 416 VLSKADLCTEIVREFPELQGKIGKEYAVLQN---ENISCCDAIEEHLKPRGPLENVPTNK 472
           +L KADL TE+V EFPELQG + + Y + +     + +  +A+ +H KP G  + VPT  
Sbjct: 390 LLCKADLPTEMVGEFPELQGIMARYYYLAETGTAADPAIAEALRDHYKPAGQGDLVPTAP 449

Query: 473 ISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLS------ 526
           +S+TV+LADKL TL  FW+I EKP+GSKDP+ALRR  LG+I+++LEN   + L       
Sbjct: 450 LSVTVALADKLTTLAMFWSIGEKPTGSKDPFALRRMALGVIQLVLENGARLSLRDSVAPL 509

Query: 527 -QFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAK 585
                  +L+ FFHDRL++YL ++  R+D IEA+L P++D+L  IV  +  ++ F ++ +
Sbjct: 510 LDTKAQADLLGFFHDRLRVYLKEKGHRYDHIEAVLTPDSDDLGLIVTRLHAIDRFLATPE 569

Query: 586 GEKFLLSAKRIFQILAIEEKKN-REISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDH 644
           G   + + KR   IL  EEKK       EI    L    E+ LY  +      +  ++  
Sbjct: 570 GGDLVAAYKRAANILKAEEKKEGGPFGGEIDTAQLEAAEEQALYTALEGVEAALAAALPK 629

Query: 645 KRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI 701
                    L S+ EP++ FF +V VNV+  E+R NRLSLL  +      V +  K+
Sbjct: 630 DDITAALAALSSLREPLDRFFTEVTVNVEAPELRKNRLSLLHRLALAFGDVADFAKL 686


>gi|284008981|emb|CBA75885.1| glycyl-tRNA synthetase beta subunit [Arsenophonus nasoniae]
          Length = 688

 Score =  618 bits (1594), Expect = e-175,   Method: Composition-based stats.
 Identities = 200/722 (27%), Positives = 343/722 (47%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L +  + +  +  Y +P RL L +  L+ +
Sbjct: 4   TFLVEIGTEELPPKALRLLAESFAANFKHQLTQAELPHGEVLWYASPRRLALKVTDLAAY 63

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+        
Sbjct: 64  QADREVEKRGPAISQAFDASGKPTKAAEGWARGCGISVEQVERLVTD--KGEWLFYRATN 121

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ ++P PK MRW    +      ++RP+ +++ +L      +++
Sbjct: 122 EGQAAQVLLGDMVVNALSQLPIPKLMRWGDKET-----QFVRPVHTVIMLL-----GDQL 171

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           ++ ++  +  G +  GHRF     + + S + Y   L     V+ D E R+  I + A++
Sbjct: 172 LEGEVLGVQSGRMIRGHRFMGEAELTIDSAEQYPAILRERGKVIADYEERKALIKHQANK 231

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
           +A  +G        LLEE+  LVEW  V    F++K+L +P E +  T+K++QK F    
Sbjct: 232 VAQQLGGTAELSDSLLEEVTSLVEWPVVLNAKFEQKFLSVPAEALVHTMKSDQKYFPVYD 291

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
           + G L   FI V+NI++S+    IV GN +V+  RL DA  F+K D              
Sbjct: 292 KVGNLMANFIFVANIESSE-PQQIVAGNEKVIRPRLADAEFFFKTD-------------- 336

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   K L++ + RL+   V+F  ++ +  ++  R+ VL   IA  I ADV    RA
Sbjct: 337 ------CKKRLEEHLPRLET--VLFQKQLDSLRDKTDRLEVLAGWIAAKIGADVNHATRA 388

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      AI+E  +PR   + +PTN ++
Sbjct: 389 GLLSKCDLMTNMVFEFTDTQGVMGMHYARRDGEAEEVALAIKEQYQPRFAGDQLPTNPVA 448

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
           + ++LADK+DTL+  + I + P G KDP+ALRRA LG++RII+E   D+ L    +    
Sbjct: 449 VALALADKMDTLVGIFGIGQPPKGDKDPFALRRAALGVLRIIVEKGYDLDLLALTQQTAQ 508

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        +++ F   R + +  ++  R D I+A+L             +K +  
Sbjct: 509 LYGDKLTNKNVIDDVVEFMLGRFRAWYQEQGYRIDTIQAVLARRPTKPADFDARVKAVTH 568

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +    E      KR+  IL    K + +++  ++   L    E  L A +      + 
Sbjct: 569 FRTLEAAEALAAVNKRVANILT---KSDEKLNDNVAASVLKAPEEVTLAAHLVVLQDKLA 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y      L S+ E I+ FFD V+V   D++VR NRL+LL  ++++ L V ++ 
Sbjct: 626 PLFADGKYQGALIELASLREVIDAFFDNVMVMDTDQKVRINRLTLLSQLRDLFLQVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LL 687


>gi|66043282|ref|YP_233123.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           syringae B728a]
 gi|75504069|sp|Q500T7|SYGB_PSEU2 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|63253989|gb|AAY35085.1| Glycyl-tRNA synthetase, beta subunit [Pseudomonas syringae pv.
           syringae B728a]
 gi|330970335|gb|EGH70401.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 684

 Score =  618 bits (1594), Expect = e-175,   Method: Composition-based stats.
 Identities = 206/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLAGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI V+NI++ D  A I+ GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDVDGKLLPRFITVANIESKD-PAQIIAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVAQFGAKIKPAGLAEQVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            IQ     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AIQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|289626617|ref|ZP_06459571.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
          Length = 684

 Score =  618 bits (1594), Expect = e-175,   Method: Composition-based stats.
 Identities = 206/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAEGKLLPRFITVANIESKD-PAQIVAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DR++    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGAKIKPAGLAEQVLDFIFDRMRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|90413726|ref|ZP_01221714.1| glycyl-tRNA synthetase beta subunit [Photobacterium profundum 3TCK]
 gi|90325195|gb|EAS41692.1| glycyl-tRNA synthetase beta subunit [Photobacterium profundum 3TCK]
          Length = 689

 Score =  618 bits (1594), Expect = e-174,   Method: Composition-based stats.
 Identities = 212/722 (29%), Positives = 340/722 (47%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+E+ +EE+P +     AE  S      LK   +++Q +  + TP RL L +  L+  
Sbjct: 5   NFLIELGTEELPPKALRTLAEAFSSNFEAELKAAALVHQGIEWFATPRRLALKVTALATG 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             + + E+ GP +       G   KA  G+ R  G+       +K   +KG+  L     
Sbjct: 65  QADSVVEKRGPAISAAFDAEGNPTKAAQGWARGNGITVEQADTLK--TEKGEWLLYKQEV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  +   A+ K+P PK MRW           +IRP+K++  +L      +++
Sbjct: 123 KGKPAQELLSGLAAAALAKLPIPKPMRWGNNE-----IQFIRPVKTLTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I+ ++       I  GHRF       + + D Y   LE    V+ + E R+  IL  A +
Sbjct: 173 IEGNILGADSARIIRGHRFMGEAEFTIDNADQYPAILEERGKVMANYEARKAIILEGAKK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  VG     + +L+EE+  LVEW  V   SF++ +L +P E +  T+K +QK F    
Sbjct: 233 AALEVGGIADLEDELVEEVTSLVEWPVVLTASFEENFLNVPSEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            EG L   FI V+NI++ D    I++GN +VV  RL DA  F+K D+             
Sbjct: 293 AEGNLIPKFIFVTNIESKD-PRQIIEGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   +PL  R+  L+    +F  ++GT  ++  RI  L   IA+ IDADV    RA
Sbjct: 339 -------KRPLVDRLPELETA--IFQKQLGTIKDKTDRITELAGYIAEKIDADVTNAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +L+K DL T +V EF + QG +G  YA    E      A+ E   PR   + +P+  +S
Sbjct: 390 GLLAKCDLMTSMVFEFTDTQGVMGMHYARHDGEAEDVALALYEQYMPRFAGDELPSTGVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL+  + I + P GS DP+ALRRA LG++RII+E   ++ L   I     
Sbjct: 450 AAVAMADKIDTLVGIFGIGQAPKGS-DPFALRRAALGVLRIIVEKGYNLDLVDLIAKARA 508

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                        ++I F   R + +  D     D+I A+L             +K ++ 
Sbjct: 509 QFGDKLTNTNVEDDVIDFMLGRFRAWYQDEGHSVDVILAVLALRPTQPADFDKRVKAVSH 568

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S    E    + KR+  ILA   K + E+ L +    L+  AEK L   +      + 
Sbjct: 569 FRSLDAAESLAAANKRVGNILA---KFDGELPLAVDSSLLIENAEKALAEKVEAMIAALA 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y Q    L ++ EP++ FFD V+V  DD +++ NRL++L  ++N  L V ++ 
Sbjct: 626 PVFAEGNYQQALSELATLREPVDAFFDNVMVMADDEKLKVNRLTMLNLLRNEFLKVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LV 687


>gi|330961519|gb|EGH61779.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 684

 Score =  618 bits (1594), Expect = e-174,   Method: Composition-based stats.
 Identities = 207/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L+  G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLQGAGLTYSAKQVYAAPRRLAVLITE 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           LS   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LSTQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTLSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPEDVRISSPAGYLSDLRAAYVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VEELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               +G L   FI V+NI++ D  A I+ GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDVDGKLLPRFITVANIESKD-PAQIIAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +      ++   +  + L     ++ 
Sbjct: 502 AVTQFGTKIKPAGLAEQVLDFIFDRLRARYEDEGVDVATYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GNIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            IQ     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AIQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|54307292|ref|YP_128312.1| glycyl-tRNA synthetase subunit beta [Photobacterium profundum SS9]
 gi|81828898|sp|Q6LW15|SYGB_PHOPR RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|46911712|emb|CAG18510.1| Putative glycyl-tRNA synthetase, beta chain [Photobacterium
           profundum SS9]
          Length = 689

 Score =  618 bits (1594), Expect = e-174,   Method: Composition-based stats.
 Identities = 212/722 (29%), Positives = 338/722 (46%), Gaps = 62/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
           +FL+E+ +EE+P +     AE  S      LK   +++Q +  + TP RL L +  L+  
Sbjct: 5   NFLIELGTEELPPKALRTLAEAFSSNFEAELKTAALVHQGIEWFATPRRLALKVTALATG 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             + + E+ GP +       G   KA  G+ R  G+       +K   +KG+  L     
Sbjct: 65  QADSVVEKRGPAISAAFDAEGNPTKAAQGWARGNGITVEQADTLK--TEKGEWLLYKQEV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  +++L  +   A+ K+P PK MRW           +IRP+K++  +L      +++
Sbjct: 123 KGKPAQELLSGLAAAALAKLPIPKPMRWGNNE-----IQFIRPVKTLTMLL-----GDEL 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I+ ++       I  GHRF       + + D Y   LE    V+ + E R+  IL  A +
Sbjct: 173 IEGNILGADSARIIRGHRFMGEAEFTIDNADQYPAILEERGKVMANYEARKAIILEGAKK 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  VG     + +L+EE+  LVEW  V   SF++ +L +P E +  T+K +QK F    
Sbjct: 233 AALEVGGIADLEDELVEEVTSLVEWPVVLTASFEENFLNVPTEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
            EG L   FI V+NI++ D    I++GN +VV  RL DA  F+K D+             
Sbjct: 293 AEGNLIPKFIFVTNIESKD-PRQIIEGNEKVVRPRLADAEFFFKTDR------------- 338

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                   +PL  R+  L+    +F  ++GT  ++  RI  L   IA+ I ADV    RA
Sbjct: 339 -------KRPLVDRLPELEKA--IFQKQLGTIKDKTDRITELAGYIAEQIGADVTNAKRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +L+K DL T +V EF + QG +G  YA    E      A+ E   PR   + +P+  +S
Sbjct: 390 GLLAKCDLMTSMVFEFTDTQGVMGMHYARHDGEAEDVALALYEQYMPRFAGDKLPSTGVS 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             V++ADK+DTL+  + I + P GS DP+ALRRA LG++RII+E    + L   I     
Sbjct: 450 AAVAMADKIDTLVGIFGIGQAPKGS-DPFALRRAALGVLRIIVEKDYSLDLVDLIAKARA 508

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D+I A+L             +K ++ 
Sbjct: 509 QFGDKLTNANVEDEVIDFMLGRFRAWYQDEGHSVDVILAVLALRPTQPADFDKRVKAVSH 568

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F S    E    + KR+  ILA   K + E+ L +    LL +AEK L   +      + 
Sbjct: 569 FRSLDAAESLAAANKRVGNILA---KFDGELPLAVDSSLLLEDAEKALAEKVEAMIATLA 625

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                  Y Q    L ++ EP++ FFD V+V  DD +++ NRL++L  ++N  L V ++ 
Sbjct: 626 PVFAEGNYQQALSELATLREPVDAFFDNVMVMADDEKLKVNRLTMLNLLRNEFLKVADIS 685

Query: 700 KI 701
            +
Sbjct: 686 LV 687


>gi|238750267|ref|ZP_04611769.1| Glycyl-tRNA synthetase beta subunit [Yersinia rohdei ATCC 43380]
 gi|238711500|gb|EEQ03716.1| Glycyl-tRNA synthetase beta subunit [Yersinia rohdei ATCC 43380]
          Length = 689

 Score =  618 bits (1593), Expect = e-174,   Method: Composition-based stats.
 Identities = 202/722 (27%), Positives = 328/722 (45%), Gaps = 61/722 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
            FL+EI +EE+P +     AE  +      L    + +  +  Y  P RL + +  LS  
Sbjct: 5   TFLVEIGTEELPPKALRSLAESFAANFTAELDNANLPHGEVIWYAAPRRLAVKVLNLSAA 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115
             ++  E+ GP +       G   KA +G+ R  G+      ++  D  KG+  L     
Sbjct: 65  QADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDEAERLVTD--KGEWLLYRAHV 122

Query: 116 PKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKI 175
             +  + +L  +V  A+ K+P PK MRW    +      ++RP+ ++  +L +E     +
Sbjct: 123 KGQSAQLLLAGMVNTALSKLPIPKLMRWGDKET-----QFVRPVHTVTLLLGSE-----L 172

Query: 176 IDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLE-EAMVLLDPECRRNAILNDAHR 234
           I   +  I    +  GHRF       + + D Y + L     V+ D E R+  I  DA  
Sbjct: 173 IPGTVLGIDSDRVIRGHRFMGEAEFTLDNADQYPQVLMERGKVIADYELRKAIIKRDAEL 232

Query: 235 LASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRT 294
            A  +G      + LLEE+  LVEW  V    F++K+L +P E +  T+K +QK F    
Sbjct: 233 AAQKIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYD 292

Query: 295 REGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESA 354
             G L   FI V+NI++ D    I+ GN +VV  RL DA  F+  D              
Sbjct: 293 TAGNLLPNFIFVTNIESKD-PQQIISGNEKVVRPRLADAEFFFNTD-------------- 337

Query: 355 LKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRA 414
                 L K L+  + RL+   V+F  ++GT  ++  RI+ L   +A  I ADV    RA
Sbjct: 338 ------LKKRLEDNLPRLET--VLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRA 389

Query: 415 IVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKIS 474
            +LSK DL T +V EF + QG +G  YA    E      A+ E  +PR   +++P+N ++
Sbjct: 390 GLLSKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVA 449

Query: 475 ITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED--- 531
             +++ADK+DTL   + I + P G KDP+ALRRA LG++RII+E  + + L    E+   
Sbjct: 450 CALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAVR 509

Query: 532 ------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNE 579
                         +I F   R + +  D     D I+A+L             +K +  
Sbjct: 510 LYGSKLTNAKVVDEVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTY 569

Query: 580 FFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQ 639
           F +         + KR+  ILA   K   +++  +    L   AE +L   +      ++
Sbjct: 570 FRTLDAAATLAAANKRVSNILA---KSTDKLNDHVHASVLKEPAELKLATHLVVLRDKLE 626

Query: 640 ESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQ 699
                 +Y +    L ++ E ++ FFD V+V  +D  VR NRL+LL  ++ + L V ++ 
Sbjct: 627 PVFAAGQYQEALVELAALRETVDEFFDSVMVMAEDDAVRVNRLTLLSKLRELFLQVADIS 686

Query: 700 KI 701
            +
Sbjct: 687 LL 688


>gi|330985731|gb|EGH83834.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 684

 Score =  618 bits (1593), Expect = e-174,   Method: Composition-based stats.
 Identities = 207/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTIHGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAEGKLLPRFITVANIESKD-PAQIVAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DRL+    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGAKIKPAGLAEQVLDFIFDRLRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DLSLL 683


>gi|289648601|ref|ZP_06479944.1| glycyl-tRNA synthetase subunit beta [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 684

 Score =  618 bits (1593), Expect = e-174,   Method: Composition-based stats.
 Identities = 206/725 (28%), Positives = 332/725 (45%), Gaps = 66/725 (9%)

Query: 1   MP--DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKG 58
           M   DFL+E+ +EE+P +     A+     +   L   G+ Y   + Y  P RL + +  
Sbjct: 1   MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLSGAGLTYSAKQVYAAPRRLAVLITA 60

Query: 59  LSPHSPEKIEERLGPR-------VGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLA 111
           L+   P++     GP         G   +A  GF +  G+      Q       G     
Sbjct: 61  LATQQPDRSVNLDGPPRQAAFDANGNPTQAALGFAKKCGVDLSEIDQS------GPKLRY 114

Query: 112 VLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDA 171
                 +    +L TIV  ++  +P  K MRW           ++RP + ++ +      
Sbjct: 115 SQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKE-----EFVRPTQWLVMLF----- 164

Query: 172 KEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILND 231
            ++++D  +     G  + GHRFH P  +++ S   Y+ DL  A VL D   RR  I   
Sbjct: 165 GDQVVDCTILAQSAGRHSRGHRFHHPQDVRISSPAGYLSDLRAAHVLADFNERRQIISKR 224

Query: 232 AHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFV 291
              LA+      +    LL+E+ GLVEW    + SF++++L +P+E +  T++ NQK F 
Sbjct: 225 VDELATQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFC 284

Query: 292 TRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLK 351
               EG L   FI V+NI++ D  A IV GN +VV  RL DA  F+K+D+          
Sbjct: 285 LLDAEGKLLPRFITVANIESKD-PAQIVAGNEKVVRPRLTDAEFFFKQDK---------- 333

Query: 352 ESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALV 411
                      + L+    RL   +VVF A++G+  ++  R+  L   IA  I  D    
Sbjct: 334 ----------KQKLETFNDRLK--NVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRA 381

Query: 412 DRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTN 471
            RA +LSK DL +E+V EFPE+QG  G  YA    E      A+ E   PRG    +PT 
Sbjct: 382 ARAGLLSKCDLSSEMVGEFPEMQGIAGYYYAKADGEPEDVALALNEQYMPRGAGAELPTT 441

Query: 472 KISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIED 531
                V++ADKLDTL+  + I   P+GSKDPYALRRA LGI+RI++E K+D+ L + ++ 
Sbjct: 442 LTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKF 501

Query: 532 ---------------QNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKH 576
                          + ++ F  DR++    D  +   +  ++   +  + L     ++ 
Sbjct: 502 AVTQFGAKIKPAGLAEQVLDFIFDRMRARYEDEGVDVAVYLSVRALQPASALDFDQRVQA 561

Query: 577 LNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGT 636
           +  F    +        KR+  +L+  E     I+  + P+Y     E  LY+ I     
Sbjct: 562 VQAFRKLPQAAALAAVNKRVSNLLSKAE---GSIAQTVEPKYFDNANEFSLYSAIQQADH 618

Query: 637 HIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI 696
            +Q     ++Y +    L  + EP++ FF+ V+VN +D  VR NR +LL  ++ + L V 
Sbjct: 619 AVQPMAAERQYSESLARLAMLREPVDAFFEAVMVNAEDANVRANRYALLSRLRGLFLGVA 678

Query: 697 NVQKI 701
           ++  +
Sbjct: 679 DISLL 683


>gi|71281166|ref|YP_266788.1| glycyl-tRNA synthetase subunit beta [Colwellia psychrerythraea 34H]
 gi|123761120|sp|Q48AS2|SYGB_COLP3 RecName: Full=Glycyl-tRNA synthetase beta subunit; AltName:
           Full=Glycine--tRNA ligase beta subunit; Short=GlyRS
 gi|71146906|gb|AAZ27379.1| glycyl-tRNA synthetase, beta subunit [Colwellia psychrerythraea
           34H]
          Length = 688

 Score =  618 bits (1593), Expect = e-174,   Method: Composition-based stats.
 Identities = 200/719 (27%), Positives = 348/719 (48%), Gaps = 60/719 (8%)

Query: 3   DFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPH 62
             L+E+ +EE+P +     A      + G L    + Y +++ + TP R  + +  L   
Sbjct: 5   TLLIELGTEELPPKSLKTLATAFYDNIKGQLDSHNLSYSDIKWFATPRRFAVQVFDLVEK 64

Query: 63  SPEKIEERLGPRV-------GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRK 115