HHsearch alignment for GI: 254781095 and conserved domain: KOG0430

>KOG0430 consensus.
Probab=96.61  E-value=0.0042  Score=39.89  Aligned_cols=157  Identities=17%  Similarity=0.179  Sum_probs=88.3

Q ss_pred             EEEEEEECCHHHHHHHHHHHHCCCCEEEECCCCEEEEEC-CCEECCHHHHCC-CCCCCEEEECCCCCCCCCEEEHHHHHH
Q ss_conf             889999689899999999856299899984752036604-884022022112-344311330266512331122156777
Q gi|254781095|r   39 AEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD-AGIRGVVLRLSN-AGFSNIEVRNHCEMIVGARCSGKSLAN  116 (318)
Q Consensus        39 A~~~~~p~s~~el~~~l~~~~~~~p~~iiG~GSNil~~D-~~~~G~vI~l~~-~~~~~i~~~~~~~i~v~AG~~~~~l~~  116 (318)
T Consensus       214 ~~~W~~P~sl~eL~~~~~--~~~~~~Lv~GNT~~gv~~r~~~~~~-~Id~~~v~el~~~~~-~~~gi~lGa~~sls~~~~  289 (1257)
T KOG0430         214 GIRWYWPVSLEELFELKA--NKPDAKLVAGNTAHGVYRRSPDYQK-FIDVSGVPELKALNV-DDNGLELGAALSLSETME  289 (1257)
T ss_pred             CCEEECCCCHHHHHHHHH--CCCCEEEEECCCCCEEEECCCCCCC-EECHHCCCHHHCCCC-CCCCEEECCCCCHHHHHH
T ss_conf             717867566999999985--2864389852533158851688761-354300841210356-877418755243999999


Q ss_pred             HHHHHH-CCC----------HHCCCCHH----HHHHHHHCCCCCCCCCEEEEEEEEEEEECCCCCEEEEC--CCCCC-CC
Q ss_conf             788752-012----------00038725----66324311573215831345666434411232100001--23344-31
Q gi|254781095|r  117 SALRHG-IGG----------FHFFYGIP----GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIP--REQLK-YQ  178 (318)
Q Consensus       117 ~~~~~g-l~G----------lE~l~gIP----GTVGGAi~mNAGayG~ei~d~i~~V~~~d~~g~~~~l~--~~e~~-f~  178 (318)
T Consensus       290 ~l~~~~~~~~~~~~~~~~~hl~~~A~~~IRN~ati~GnI~~~~~~~-~f~SDl~~~l~a~~a~v~~~~~~~~~~~~~l~~  368 (1257)
T KOG0430         290 LLRKLVKRPGFEYFKALWEHLKWFANVQIRNVGTIGGNICTKAQSP-EFPSDLFILLEALDAKVTILNNSGDLEKVFLEE  368 (1257)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHCCCCEECCCCCCCEEEECCCCC-CCCHHHHHHHHHHCCEEEEEECCCCCCEEEHHH
T ss_conf             9999870728889999999998750500002210034166426787-785067889876236899860688621453866


Q ss_pred             CCCCCCCCCCCEEEEECCCCCC
Q ss_conf             0023224676200100235456
Q gi|254781095|r  179 YRSSEITKDLIITHVVLRGFPE  200 (318)
Q Consensus       179 YR~S~~~~~~iIl~a~l~l~~~  200 (318)
T Consensus       369 y~~~~l~~~~illsv~ip~~~~  390 (1257)
T KOG0430         369 YLGSSLGAKEILLSVVLPASRK  390 (1257)
T ss_pred             HHCCCCCCCEEEEEEECCCCHH
T ss_conf             6446567230789997267389