HHsearch alignment for GI: 254781095 and conserved domain: PRK09971

>PRK09971 xanthine dehydrogenase subunit XdhB; Provisional.
Probab=97.37  E-value=0.00023  Score=47.86  Aligned_cols=148  Identities=13%  Similarity=0.209  Sum_probs=95.3

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCCEEEECCCCEEEEE--CC-CEECCHHHHCCC-CCCCEEEECCCCCCCCCEEEHHHHH
Q ss_conf             8999968989999999985629989998475203660--48-840220221123-4431133026651233112215677
Q gi|254781095|r   40 EVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR--DA-GIRGVVLRLSNA-GFSNIEVRNHCEMIVGARCSGKSLA  115 (318)
Q Consensus        40 ~~~~~p~s~~el~~~l~~~~~~~p~~iiG~GSNil~~--D~-~~~G~vI~l~~~-~~~~i~~~~~~~i~v~AG~~~~~l~  115 (318)
T Consensus         5 ~~Y~~P~sl~eA~~ll~~~~---~a~ilAGGTdL~~~~~~~~~~~~~lIdi~~I~eL~~I~~~~dg~l~IGA~vT~~el~   81 (292)
T PRK09971          5 AEYHEAATLADAIELLADNP---QAKLIAGGTDVLIQLHHHNDRYRHLVDIRNIAELRGITLAEDGSIRIGAATTFTQII   81 (292)
T ss_pred             CCEECCCCHHHHHHHHHHCC---CCEEEECCCHHHHHHHCCCCCCCEEEECCCCHHHCCEEECCCCCEEEEECCCHHHHH
T ss_conf             54728899999999984199---987996373189998568899885888357825457788799839997067289875


Q ss_pred             HHH-HHHHCCCHHCC---CCHH-----HHHHHHHCCCCCCCCCEEEEEE-------EEEEEECCCCCEEEECCCCCCCCC
Q ss_conf             778-87520120003---8725-----6632431157321583134566-------643441123210000123344310
Q gi|254781095|r  116 NSA-LRHGIGGFHFF---YGIP-----GSIGGAAYMNAGANNCETSQYV-------VEVHGIDRKGNQHVIPREQLKYQY  179 (318)
Q Consensus       116 ~~~-~~~gl~GlE~l---~gIP-----GTVGGAi~mNAGayG~ei~d~i-------~~V~~~d~~g~~~~l~~~e~~f~Y  179 (318)
T Consensus        82 ~~~~i~~~~p~L~~a~~~ig~~qIRN~aTiGGni~~a~-----p~~D~~p~LlaldA~v~i~s~~g-~R~ipl~dF~~g~  155 (292)
T PRK09971         82 EDPIVQRHLPALAEAAVSIGGPQIRNVATIGGNICNGA-----TSADSATPLFALDAKLELHSPNG-VRFVPINGFYTGP  155 (292)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCC-----CCCHHHHHHHHHHCEEEEECCCC-CEECCHHHHCCCC
T ss_conf             19688866669999999738996702414366544678-----75016799999640468973899-7733389962575


Q ss_pred             CCCCCCCCCCEEEEECC
Q ss_conf             02322467620010023
Q gi|254781095|r  180 RSSEITKDLIITHVVLR  196 (318)
Q Consensus       180 R~S~~~~~~iIl~a~l~  196 (318)
T Consensus       156 ~~t~l~~~Eil~~I~ip  172 (292)
T PRK09971        156 GKVSLEHDEILVAFHIP  172 (292)
T ss_pred             CCCCCCCCCEEEEEEEC
T ss_conf             53335775369999974