HHsearch alignment for GI: 254781095 and conserved domain: PRK11230

>PRK11230 glycolate oxidase subunit GlcD; Provisional.
Probab=99.68  E-value=1.4e-16  Score=125.01  Aligned_cols=191  Identities=16%  Similarity=0.234  Sum_probs=138.2

Q ss_pred             HHHHHHHHHHHCC-EE-EECCCCCCCCCC---CCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEEECC-C
Q ss_conf             9999999875066-27-754880015225---76614889999689899999999856-2998999847520366048-8
Q gi|254781095|r    7 SRLLRERGKQLRG-KF-QENFPLKQITWF---RTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA-G   79 (318)
Q Consensus         7 ~~~l~~~~~~~~g-~i-~~n~~L~~~tt~---rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~~D~-~   79 (318)
T Consensus        19 ~~ll~~L~~~lg~~~Vl~~~~~l~~y~~D~~~~~~~~P~aVv~P~s~eeV~~iv~~a~~~~ipvvprGggTgL~Gga~p~   98 (499)
T PRK11230         19 TALLAALREHLPDLEILHTDEDLRPYECDGLSAYRTTPLLVVLPKQMEQVQALLAVCHRLRVPVVARGAGTGLSGGALPL   98 (499)
T ss_pred             HHHHHHHHHHCCCCCEECCHHHHHHHCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC
T ss_conf             99999999767985188588897651357865566898889940999999999999998799099978983226581268


Q ss_pred             EECCHHHHCCCCCCCEEEEC-CCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHH-----HHHHHHHCCCCCC-----CC
Q ss_conf             40220221123443113302-6651233112215677778875201200038725-----6632431157321-----58
Q gi|254781095|r   80 IRGVVLRLSNAGFSNIEVRN-HCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP-----GSIGGAAYMNAGA-----NN  148 (318)
Q Consensus        80 ~~G~vI~l~~~~~~~i~~~~-~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIP-----GTVGGAi~mNAGa-----yG  148 (318)
T Consensus        99 ~~gIvl~l~rmn-~Ileid~~~~~v~VeaGv~~~~l~~~l~~~Gl~----~p~dP~S~~~~tIGG~iAtNAgG~~~~rYG  173 (499)
T PRK11230         99 EKGVLLVMARFN-RILDIDPVGRRARVQPGVRNLAISQAAAPHGLY----YAPDPSSQIACSIGGNVAENAGGVHCLKYG  173 (499)
T ss_pred             CCEEEEEECCCC-CEEEEECCCCEEEEECCCCHHHHHHHHHHCCCC----CCCCCCCCCCCCCCEEEECCCCCCCEEEEC
T ss_conf             982999800127-706882689979994581079999989866985----488987233552530773078786303315


Q ss_pred             CEEEEEEEEEEEECCCCCEEEECCCC---CCCCCCCCCCCCC---CCEEEEECCCCCCCCC
Q ss_conf             31345666434411232100001233---4431002322467---6200100235456543
Q gi|254781095|r  149 CETSQYVVEVHGIDRKGNQHVIPREQ---LKYQYRSSEITKD---LIITHVVLRGFPESQN  203 (318)
Q Consensus       149 ~ei~d~i~~V~~~d~~g~~~~l~~~e---~~f~YR~S~~~~~---~iIl~a~l~l~~~~~~  203 (318)
T Consensus       174 ~-trd~VlglevVlpdG~v~~~g~~~~~~~GydL~~LfiGSEGTLGIIT~a~LrL~p~P~~  233 (499)
T PRK11230        174 L-TVHNLLKVEILTLDGERLTLGSDALDSPGFDLLALFTGSEGMLGVVTEVTVKLLPKPPV  233 (499)
T ss_pred             C-HHHHHHCCEEEECCCCEECCCCCCCCCCCCCHHHHCCCCCCCEEEEEEEEEEEECCCCE
T ss_conf             6-89975104389368862115886678898477875357786238998999998747860