HHsearch alignment for GI: 254781095 and conserved domain: PRK11282

>PRK11282 glcE glycolate oxidase FAD binding subunit; Provisional.
Probab=99.50  E-value=7.7e-14  Score=107.75  Aligned_cols=155  Identities=15%  Similarity=0.145  Sum_probs=113.0

Q ss_pred             CCHHHHHHHHHHH-HCCCCEEEECCCCEEEEECCCEECCHHHHCCCCCCCEEEEC-CCCCCCCCEEEHHHHHHHHHHHHC
Q ss_conf             8989999999985-62998999847520366048840220221123443113302-665123311221567777887520
Q gi|254781095|r   46 QDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRN-HCEMIVGARCSGKSLANSALRHGI  123 (318)
Q Consensus        46 ~s~~el~~~l~~~-~~~~p~~iiG~GSNil~~D~~~~G~vI~l~~~~~~~i~~~~-~~~i~v~AG~~~~~l~~~~~~~gl  123 (318)
T Consensus         2 ~~taev~e~Vr~A~~~~~pv~p~G~gT~~~~G-~~~~g~vl~l~rm~-~I~~~~~~d~~v~VeaGv~~~~L~~~la~~G~   79 (351)
T PRK11282          2 DISAALLERVRQAAADGTPLRIRGGGSKAFYG-RALAGEVLDTRAHR-GIVSYDPTELVITARAGTPLAELEAALAEAGQ   79 (351)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC-CCCCCEEEECCCCC-CCEEECCCCCEEEECCCCCHHHHHHHHHHCCC
T ss_conf             61899999999999879928998999788878-89998598852468-71798588897999589819999999997088


Q ss_pred             C-CHHCCC-CHHHHHHHHHCCCCCC-----CCCEEEEEEEEEEEECCCCCEEEECCCC--CCCCCCCCCCC--CC---CC
Q ss_conf             1-200038-7256632431157321-----5831345666434411232100001233--44310023224--67---62
Q gi|254781095|r  124 G-GFHFFY-GIPGSIGGAAYMNAGA-----NNCETSQYVVEVHGIDRKGNQHVIPREQ--LKYQYRSSEIT--KD---LI  189 (318)
Q Consensus       124 ~-GlE~l~-gIPGTVGGAi~mNAGa-----yG~ei~d~i~~V~~~d~~g~~~~l~~~e--~~f~YR~S~~~--~~---~i  189 (318)
T Consensus        80 ~l~~dPp~~~~~aTIGG~vAtNagG~r~~rYG~-tRD~VLGl~vVl~dG~vi~~Gg~~~KnvaGYDL~~L~vGSEGTLGv  158 (351)
T PRK11282         80 MLPFEPPHFGGGATVGGMVAAGLSGPRRPWAGA-VRDFVLGTRLINGRGEHLRFGGQVMKNVAGYDVSRLMAGSLGTLGV  158 (351)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCC-HHHHEEEEEEECCCCEEEEECCEECCCCCCCCHHHHHCCCCCCCEE
T ss_conf             224588777875434778882799742013588-8883754699878956996088024678775877874558750012


Q ss_pred             EEEEECCCCCCCCC
Q ss_conf             00100235456543
Q gi|254781095|r  190 ITHVVLRGFPESQN  203 (318)
Q Consensus       190 Il~a~l~l~~~~~~  203 (318)
T Consensus       159 ITeatLrL~P~P~~  172 (351)
T PRK11282        159 LLEVSLKVLPRPRA  172 (351)
T ss_pred             EEEEEEEECCCCCC
T ss_conf             25889997478864