HHsearch alignment for GI: 254781095 and conserved domain: TIGR00387

>TIGR00387 glcD glycolate oxidase, subunit GlcD; InterPro: IPR004490 The glc locus of Escherichia coli encodes the subunits of glycolate oxidase and the glc regulator protein. The subunit GlcD is similar to that of several D-lactate dehydrogenases, including that of E. coli. Glycolate oxidase has been found to have some D-lactate dehydrogenase activity.; GO: 0008891 glycolate oxidase activity, 0009339 glycolate oxidase complex.
Probab=99.32  E-value=6.2e-13  Score=102.01  Aligned_cols=155  Identities=21%  Similarity=0.293  Sum_probs=117.0

Q ss_pred             EEEECCHHHHHHHHHHH-HCCCCEEEECCCCEEEEECCCE-ECCHHHHCCCCCCCEE-EEC-CCCCCCCCEEEHHHHHHH
Q ss_conf             99968989999999985-6299899984752036604884-0220221123443113-302-665123311221567777
Q gi|254781095|r   42 MFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGI-RGVVLRLSNAGFSNIE-VRN-HCEMIVGARCSGKSLANS  117 (318)
Q Consensus        42 ~~~p~s~~el~~~l~~~-~~~~p~~iiG~GSNil~~D~~~-~G~vI~l~~~~~~~i~-~~~-~~~i~v~AG~~~~~l~~~  117 (318)
T Consensus         1 Vv~P~n~eqv~~Ilk~C~e~ri~~vpRGaGTgLsGGalP~~ggl~lsv~-~~m~~ILeId~~n~~A~VqPGV~~~~~~~~   79 (437)
T TIGR00387         1 VVLPKNTEQVARILKLCHEHRIPIVPRGAGTGLSGGALPVEGGLVLSVF-KRMNKILEIDVVNLTAVVQPGVINLELEQA   79 (437)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCHHHHHH-HHHHHHHHCCCCCCEEEECCCEEHHHHHHH
T ss_conf             9788857899999998742787478526888776654256773023577-887676400478888987474013889999


Q ss_pred             HHHHHCCCHHCCCCHHH-----HHHHHHCCCCCC-----CCCEEEEEEEEEEEECCCCCEEE-ECCCC-CCCCCCCCCCC
Q ss_conf             88752012000387256-----632431157321-----58313456664344112321000-01233-44310023224
Q gi|254781095|r  118 ALRHGIGGFHFFYGIPG-----SIGGAAYMNAGA-----NNCETSQYVVEVHGIDRKGNQHV-IPREQ-LKYQYRSSEIT  185 (318)
Q Consensus       118 ~~~~gl~GlE~l~gIPG-----TVGGAi~mNAGa-----yG~ei~d~i~~V~~~d~~g~~~~-l~~~e-~~f~YR~S~~~  185 (318)
T Consensus        80 V~~~~l~----YpPDPsS~~~~tiGGNiaENaGG~r~lKYG~-t~d~VlgLeVV~adGei~~~gg~~~kd~~GydLt~Lf  154 (437)
T TIGR00387        80 VEEHGLF----YPPDPSSQIVSTIGGNIAENAGGVRGLKYGT-TVDYVLGLEVVLADGEIIRIGGKTAKDVAGYDLTGLF  154 (437)
T ss_pred             HHHCCCC----CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHH-HHHEEEEEEEECCCCHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             8737872----4888011010004763003775301211011-2212333346636714321113414668862377788


Q ss_pred             --CC---CCEEEEECCCCCCCC
Q ss_conf             --67---620010023545654
Q gi|254781095|r  186 --KD---LIITHVVLRGFPESQ  202 (318)
Q Consensus       186 --~~---~iIl~a~l~l~~~~~  202 (318)
T Consensus       155 vGSEGtLGi~Te~tlKllpkPe  176 (437)
T TIGR00387       155 VGSEGTLGIVTEITLKLLPKPE  176 (437)
T ss_pred             HHCCCHHHHHHHHHHHHCCCCC
T ss_conf             7404157999989986306785