HHsearch alignment for GI: 254781095 and conserved domain: TIGR01679

>TIGR01679 bact_FAD_ox FAD-linked oxidoreductase; InterPro: IPR010032 This entry identifies a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (1.1.3.8 from EC) from rat and D-arabinono-1,4-lactone oxidase (1.1.3.37 from EC) from Saccharomyces cerevisiae..
Probab=98.64  E-value=1e-07  Score=69.00  Aligned_cols=151  Identities=21%  Similarity=0.247  Sum_probs=111.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHC-CCCEEEECCCC---EEEEECCCEECCHHHHCCCCCCCEEEE-CCCCCCCCCEEEHHHH
Q ss_conf             899996898999999998562-99899984752---036604884022022112344311330-2665123311221567
Q gi|254781095|r   40 EVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGS---NILVRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSL  114 (318)
Q Consensus        40 ~~~~~p~s~~el~~~l~~~~~-~~p~~iiG~GS---Nil~~D~~~~G~vI~l~~~~~~~i~~~-~~~~i~v~AG~~~~~l  114 (318)
T Consensus        13 ~ai~~P~degELad~~~~A~~pGervR~VGsGHSFT~la~t----dGt~~sl~~l~-g~v~~d~~~~~a~V~aGtrLgaL   87 (426)
T TIGR01679        13 SAIVAPKDEGELADVVKVAAKPGERVRAVGSGHSFTDLAKT----DGTLVSLEKLE-GVVDVDQQKDEAIVKAGTRLGAL   87 (426)
T ss_pred             CEECCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC----CCEEEECCCCC-EEEEECCCCCEEEEECCCCCCCH
T ss_conf             00117886014899999723889766544377650133366----86578731165-04300289886899506521404


Q ss_pred             HHHHHHHHCCCHHCCCCH-HHHHHHHHCCCCCCCC-----CEEEEEEEEEEEECCCCCEEEECCCC---CCCCCCCCCCC
Q ss_conf             777887520120003872-5663243115732158-----31345666434411232100001233---44310023224
Q gi|254781095|r  115 ANSALRHGIGGFHFFYGI-PGSIGGAAYMNAGANN-----CETSQYVVEVHGIDRKGNQHVIPREQ---LKYQYRSSEIT  185 (318)
Q Consensus       115 ~~~~~~~gl~GlE~l~gI-PGTVGGAi~mNAGayG-----~ei~d~i~~V~~~d~~g~~~~l~~~e---~~f~YR~S~~~  185 (318)
T Consensus        88 gp~La~~g~-gL~N~gDid~QsigGAlgTAT--HGtG~~~~a~h~~~~~lrlVt~~Gkv~d~~~~~d~~~~~AarVs-lG  163 (426)
T TIGR01679        88 GPLLAEKGR-GLENLGDIDKQSIGGALGTAT--HGTGVKLQALHARVVSLRLVTASGKVLDLSEADDQDIYLAARVS-LG  163 (426)
T ss_pred             HHHHHHHCC-CCCCCCCCCHHHHHHHHHHCC--CCCCCCCCCCCEEEEEEEEECCCCCEEECCCCCCHHHHHHHHHH-HH
T ss_conf             589997514-566778866013211101021--57886333542067899998588707875568787799999888-64


Q ss_pred             CCCCEEEEECCCCC
Q ss_conf             67620010023545
Q gi|254781095|r  186 KDLIITHVVLRGFP  199 (318)
Q Consensus       186 ~~~iIl~a~l~l~~  199 (318)
T Consensus       164 AlGViSqVtl~t~a  177 (426)
T TIGR01679       164 ALGVISQVTLRTVA  177 (426)
T ss_pred             HHCHHHEEEECCCC
T ss_conf             30101001101254