HHsearch alignment of GI: 254781095 and MMDB domain: 1e8g_A_1-126

>1e8g_A (A:1-126) Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum}
Probab=96.69  E-value=0.0014  Score=42.55  Aligned_cols=57  Identities=18%  Similarity=0.188  Sum_probs=44.8

Q ss_pred             CCCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEEE---CCCEECCHHHHCC
Q ss_conf             576614889999689899999999856-29989998475203660---4884022022112
Q gi|254781095|r   33 FRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVR---DAGIRGVVLRLSN   89 (318)
Q Consensus        33 ~rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~~---D~~~~G~vI~l~~   89 (318)
                      .+.......++.|++.+|+++++++|. +++|+.+.|+|+++--.   ..-.+|++|.+++
T Consensus        65 ~~~~~~P~aVv~P~~~~eV~~ivk~a~~~~i~v~~rggG~~~~g~~~~~~~~~giviDlsR  125 (126)
T 1e8g_A           65 DQDYFLASAIVAPRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGK  125 (126)
T ss_dssp             CTTSSCCSEEECCSSHHHHHHHHHHHHHHTCCEEEESSCCCTTTTTTCCSSTTCEEEECTT
T ss_pred             CCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             6656688789966999999999999998799389977998878888741579969998722