HHsearch alignment of GI: 254781095 and MMDB domain: 1hsk_A_100-230

>1hsk_A (A:100-230) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus}
Probab=99.84  E-value=4.5e-22  Score=159.37  Aligned_cols=123  Identities=29%  Similarity=0.467  Sum_probs=118.1

Q ss_pred             CCCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCCCCCCC
Q ss_conf             26651233112215677778875201200038725663243115732158313456664344112321000012334431
Q gi|254781095|r   99 NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ  178 (318)
Q Consensus        99 ~~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGayG~ei~d~i~~V~~~d~~g~~~~l~~~e~~f~  178 (318)
                      +...++|+||+.|.+|.+++.++||.+.++.+++||||||++.||+++++++++|++.++++++.+|++.++++++++|.
T Consensus         8 ~~~~v~v~aGv~~~~l~~~l~~~G~~~~~~~~~~~g~igg~~~~~~~~~~g~~~d~v~~~~~v~~~G~i~~~~~~~~~~~   87 (131)
T 1hsk_A            8 SDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELD   87 (131)
T ss_dssp             ETTEEEEETTSBHHHHHHHHHHTTEESCGGGTTCCSBHHHHHHHTCEETTEEHHHHEEEEEEECTTSCEEEEETTTTTCB
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEECHHHHHHH
T ss_conf             49839996485079999999984679834687437435000112566677267899888999944996898226776565


Q ss_pred             CCCCCCCC-CCCEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCC
Q ss_conf             00232246-76200100235456543100122210011000155
Q gi|254781095|r  179 YRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQP  221 (318)
Q Consensus       179 YR~S~~~~-~~iIl~a~l~l~~~~~~~i~~~~~~~~~~R~~~qP  221 (318)
                      ||.+.++. ..||++++|++.|..+..+...+.++.+.|+++||
T Consensus        88 ~~~~~~~~~~GIit~~~l~l~~~~~~~i~~~~~~~~~~r~~~~P  131 (131)
T 1hsk_A           88 YRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQP  131 (131)
T ss_dssp             TTBCHHHHTTCEEEEEEEECEECCHHHHHHHHHHHHHHHHHHSC
T ss_pred             HCCCCCCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             41666776652899899865368816779999999998860498