HHsearch alignment of GI: 254781095 and MMDB domain: 2exr_A_116-238_483-524

>2exr_A (A:116-238,A:483-524) Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A*
Probab=98.39  E-value=7.4e-08  Score=69.53  Aligned_cols=137  Identities=10%  Similarity=0.072  Sum_probs=92.9

Q ss_pred             CCEEEEC-CCCCCCCCEEEHHHHHHHHHHH-HCCCHHCCCCHHHHHHHHHCCCCCC-----CCCEEEEEEEEEEEECCCC
Q ss_conf             3113302-6651233112215677778875-2012000387256632431157321-----5831345666434411232
Q gi|254781095|r   93 SNIEVRN-HCEMIVGARCSGKSLANSALRH-GIGGFHFFYGIPGSIGGAAYMNAGA-----NNCETSQYVVEVHGIDRKG  165 (318)
Q Consensus        93 ~~i~~~~-~~~i~v~AG~~~~~l~~~~~~~-gl~GlE~l~gIPGTVGGAi~mNAGa-----yG~ei~d~i~~V~~~d~~g  165 (318)
                      +.++++. ...++|++|+.+.++.+++.++ ++.....-+.--.||||++.+|++.     ||. .+|++.++++++++|
T Consensus         8 ~ii~id~~~~~v~VeaGv~~~dl~~~ll~~~gl~~p~~~s~~~~TiGG~ia~g~~G~~s~~yG~-~~d~v~~levVl~dG   86 (165)
T 2exr_A            8 GYLSGGDATAFVDVSGGALWEDVLKRCVSEYGLAPRSWTDYLGLTVGGTLSNAGVSGQAFRYGP-QTSNVTELDVVTGNG   86 (165)
T ss_dssp             EECCSSSSSEEEEEETTCBHHHHHHHHHHHHSEECSCCCSCCSSBHHHHHTTCCCCTTHHHHCC-GGGSEEEEEEEETTS
T ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCEEEEEEECCCC
T ss_conf             6135428899899907959999999999849864678988786603322345422223332022-222135789984888


Q ss_pred             CEEEECCCC---CCCCCCCCCCCCCCCEEEEECCCCCCCC--CCCH----HHHHHCCCCCCCCCCCCCEEEEEEE
Q ss_conf             100001233---4431002322467620010023545654--3100----1222100110001556670465889
Q gi|254781095|r  166 NQHVIPREQ---LKYQYRSSEITKDLIITHVVLRGFPESQ--NIIS----AAIANVCHHRETVQPIKEKTGGSTF  231 (318)
Q Consensus       166 ~~~~l~~~e---~~f~YR~S~~~~~~iIl~a~l~l~~~~~--~~i~----~~~~~~~~~R~~~qP~~~~s~GSvF  231 (318)
                      ++.+.++.+   +....|.| ...-.||++++|++.|.-+  ++-.    .+..++++.+....|...-+-|.-|
T Consensus        87 ~i~~~~~~~~~dlf~a~~Gs-~G~lGIIT~vtlrl~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (165)
T 2exr_A           87 DVVTCSEIENSELFFSVLGG-LGQFGIITRARVLLQPAYKSQEEWIRHFGNRWSRFVDRKAXFDPXAILSPGQKI  160 (165)
T ss_dssp             CEEEEESSSSHHHHHHHTTC-TTSSEEEEEEEEEEEECCCSHHHHHHHHGGGHHHHHHHHHHHCTTCCBCGGGCS
T ss_pred             CEEEEECCCCCCCCCCCCCC-CCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             67999644443322332246-674422147887223684587999998889999999999976953368999887