HHsearch alignment of GI: 254781095 and MMDB domain: 2ipi_A_1-237_481-521

>2ipi_A (A:1-237,A:481-521) Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus}
Probab=99.71  E-value=3.8e-17  Score=128.21  Aligned_cols=196  Identities=8%  Similarity=-0.043  Sum_probs=145.2

Q ss_pred             CCCCEEEEEEEECCHHHHHHHHHHH-HCCCCEEEECCCCEEEEECCCEECCHHHHCCCCCCCEEEEC-CCCCCCCCEEEH
Q ss_conf             7661488999968989999999985-62998999847520366048840220221123443113302-665123311221
Q gi|254781095|r   34 RTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRN-HCEMIVGARCSG  111 (318)
Q Consensus        34 rvGG~A~~~~~p~s~~el~~~l~~~-~~~~p~~iiG~GSNil~~D~~~~G~vI~l~~~~~~~i~~~~-~~~i~v~AG~~~  111 (318)
                      ...+..+.++.|++++|+.++++++ ++++|+.+.|+|+|..-.....++.+|.+... +..++++. ...++|+||+.|
T Consensus        51 ~~~~~P~~Vv~P~s~eeV~~iv~~a~~~~~~v~~rGgGhs~~g~~~~~~~~vi~~~~~-~~~~~~d~~~~~v~v~aG~~~  129 (278)
T 2ipi_A           51 RFRGRPDVVYVVHTADQVVDAVNQAMAAGQRIAVRSGGHCFEGFVDDPAVRAVIDMSQ-MRQVFYDSGKRAFAVEPGATL  129 (278)
T ss_dssp             TCCCCCSEEEECSSHHHHHHHHHHHHHHTCCEEEESSCCCTTCGGGCTTCCEEEECTT-CCCEEEETTTTEEEECTTSBH
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCC-CCCEEECCCCCEEEECCCCCH
T ss_conf             6768998899559999999999999987980999899837563836779759998778-998798389998999068199


Q ss_pred             HHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCC-----CCCEEEEEEEEEEEECCCCCEEEEC----------CCCCC
Q ss_conf             56777788752012000387256632431157321-----5831345666434411232100001----------23344
Q gi|254781095|r  112 KSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGA-----NNCETSQYVVEVHGIDRKGNQHVIP----------REQLK  176 (318)
Q Consensus       112 ~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGa-----yG~ei~d~i~~V~~~d~~g~~~~l~----------~~e~~  176 (318)
                      .++.+.+.++|+......+.-++|+||++.+|++.     || .+.|++.++++++.+|++..+.          ..|+.
T Consensus       130 ~~l~~~l~~~g~~~~~~~~~~~~tiGG~~~~~~~g~~s~~~G-~~~d~v~~~~vV~~dG~~~~~~~~~~~~~~~~~~dlf  208 (278)
T 2ipi_A          130 GETYRALYLDWGVTIPAGVCPQVGVGGHVLGGGYGPLSRRDG-VVADHLYAVEVVVVDASGRARKVVATSAADDPNRELW  208 (278)
T ss_dssp             HHHHHHHHHHHSBCCCCCSCTTCBHHHHTTTTCCCTTHHHHC-CGGGGEEEEEEEEECTTSCEEEEEEECCTTCTTHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC-CCCCCEEEEEEEEECCEEEEEEEEEECCCCCCCCHHH
T ss_conf             999999997189243798767302357677886078768664-0004401379998778089975322012235544899


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCH-----------HHHHHCCCCCCCCCCCCCEEEEEEEECCCCC
Q ss_conf             310023224676200100235456543100-----------1222100110001556670465889727898
Q gi|254781095|r  177 YQYRSSEITKDLIITHVVLRGFPESQNIIS-----------AAIANVCHHRETVQPIKEKTGGSTFKNPTGH  237 (318)
Q Consensus       177 f~YR~S~~~~~~iIl~a~l~l~~~~~~~i~-----------~~~~~~~~~R~~~qP~~~~s~GSvFkNP~~~  237 (318)
                      ++.|......-.||++++|++.|..+....           .....+.+.+.+..|.+      ||++|...
T Consensus       209 ~a~~~Gs~G~lGIVt~~tlrl~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~  274 (278)
T 2ipi_A          209 WAHTGGGGGNFGIVTRYWFRTPGATGTDPTSGVPWYTLYYKGNYPRLQKVKARWDPRD------VFRHALSV  274 (278)
T ss_dssp             HHTTTSCSSSSCEEEEEEECCSSCCSSCGCCSCCHHHHHHGGGHHHHHHHHHHHCTTC------CSCCTTCC
T ss_pred             HHHHHHHHCCCCEEEEEEEEEECCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCC------CCCCCCCC
T ss_conf             9887531011313799999941588626810126899865789999999999769625------67989794