HHsearch alignment of GI: 254781095 and MMDB domain: 2uuu_A_77-193

>2uuu_A (A:77-193) Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A*
Probab=97.02  E-value=0.0003  Score=46.73  Aligned_cols=60  Identities=13%  Similarity=0.112  Sum_probs=48.7

Q ss_pred             CCCCCCEEEEEEEECCHHHHHHHHHHH-HCCCCEEEECCCCEEEEEC-CCEECCHHHHCCCC
Q ss_conf             257661488999968989999999985-6299899984752036604-88402202211234
Q gi|254781095|r   32 WFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD-AGIRGVVLRLSNAG   91 (318)
Q Consensus        32 t~rvGG~A~~~~~p~s~~el~~~l~~~-~~~~p~~iiG~GSNil~~D-~~~~G~vI~l~~~~   91 (318)
                      +.+..+....+++|+|.+|+..++++| ++++|+.+.|+|+|+.-.- ...+|++|.+++++
T Consensus        55 ~~~~~~~P~~vv~P~s~~eV~~iv~~a~~~~ipv~~rggG~~~~g~~~~~~~gi~idl~~mn  116 (117)
T 2uuu_A           55 IGQVKNAPDLIVLPHSHEEVERLVQLAHKYNVVIIPMGGGSNIVGAIEPVSNERFTVSIDMR  116 (117)
T ss_dssp             TTCCCCCCSEEECCCSHHHHHHHHHHHHHHTCEEEEESSCCCSSCTTSCCCCSSCEEEEECT
T ss_pred             CCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             79878998589954999999999999998799689848998888875116898459999867