HHsearch results for GI: 254781095 and protein with PDBid: 1n62_C

>1n62_C Carbon monoxide dehydrogenase medium chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5} SCOP: d.87.2.1 d.145.1.3 PDB: 1n5w_C* 1n61_C* 1n60_C* 1n63_C* 1zxi_C*
Probab=97.62  E-value=0.00011  Score=48.59  Aligned_cols=154  Identities=16%  Similarity=0.196  Sum_probs=96.4

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCCEEEECCCCEEEE--ECC-CEECCHHHHCCC-CCCCEEEECCCCCCCCCEEEHHHHHH
Q ss_conf             99996898999999998562998999847520366--048-840220221123-44311330266512331122156777
Q gi|254781095|r   41 VMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV--RDA-GIRGVVLRLSNA-GFSNIEVRNHCEMIVGARCSGKSLAN  116 (318)
Q Consensus        41 ~~~~p~s~~el~~~l~~~~~~~p~~iiG~GSNil~--~D~-~~~G~vI~l~~~-~~~~i~~~~~~~i~v~AG~~~~~l~~  116 (318)
                      -|+.|+|.+|+.+++....  -...++.||+-++.  ..+ .-+..+|.++.- .+..|+..++ .++.||++.+.++..
T Consensus         7 ~y~~P~tl~Ea~~ll~~~~--~~a~~laGGTdl~~~~~~~~~~p~~lIdl~~i~eL~~I~~~~~-~l~iGa~vt~~~l~~   83 (288)
T 1n62_C            7 DYHRPKSIADAVALLTKLG--EDARPLAGGHSLIPIMKTRLATPEHLVDLRDIGDLVGIREEGT-DVVIGAMTTQHALIG   83 (288)
T ss_dssp             EEECCSSHHHHHHHHHHHG--GGEEEESSCTTHHHHHHTTSCCCSEEEECTTCGGGSCEEEETT-EEEEETTCBHHHHHH
T ss_pred             CEECCCCHHHHHHHHHHHC--CCCEEEEECCHHHHHHHCCCCCCCEEEECCCCCCCCEEEECCC-EEEECCCCHHHHHHC
T ss_conf             3669899999999998519--9988999454799998558899996998988757663887486-799812654999861


Q ss_pred             HHH-HHHCCC----HHCCCCHH----HHHHHHHCCCCCCCCCEEEEEE----EEEEEECCCCCEEEECCCCCCCCCCCCC
Q ss_conf             788-752012----00038725----6632431157321583134566----6434411232100001233443100232
Q gi|254781095|r  117 SAL-RHGIGG----FHFFYGIP----GSIGGAAYMNAGANNCETSQYV----VEVHGIDRKGNQHVIPREQLKYQYRSSE  183 (318)
Q Consensus       117 ~~~-~~gl~G----lE~l~gIP----GTVGGAi~mNAGayG~ei~d~i----~~V~~~d~~g~~~~l~~~e~~f~YR~S~  183 (318)
                      ... ...+..    +...++.+    |||||.++ |+-..+. +.-.+    ..|++...+| .+++.-+|+--+|+.+.
T Consensus        84 ~~~~~~~~p~l~~a~~~ia~~qIRN~aTiGGNi~-~a~p~~d-~~~~l~Al~A~v~l~s~~g-~r~v~~~df~~g~~~t~  160 (288)
T 1n62_C           84 SDFLAAKLPIIRETSLLIADPQIRYMGTIGGNAA-NGDPGND-MPALMQCLGAAYELTGPEG-ARIVAARDYYQGAYFTA  160 (288)
T ss_dssp             CHHHHHHCHHHHHHHTTSSCHHHHHHCBHHHHHH-SCCTTCS-HHHHHHHHTCEEEEEETTE-EEEEEHHHHEEETTEES
T ss_pred             CHHHHHHCHHHHHHHHHCCCHHHCCCEEECCCCC-CCCCCCC-CHHHHHHHCCCCEEECCCC-CCCCCCCCCCCCCCCCC
T ss_conf             6455435659999987118997801002357222-5577642-2588987420406534788-42354201347743314


Q ss_pred             CCCCCCEEEEECCCCCC
Q ss_conf             24676200100235456
Q gi|254781095|r  184 ITKDLIITHVVLRGFPE  200 (318)
Q Consensus       184 ~~~~~iIl~a~l~l~~~  200 (318)
                      ++.+.+++++.+...+.
T Consensus       161 l~~~Eil~~I~iP~~~~  177 (288)
T 1n62_C          161 IEPGELLTAIRIPVPPT  177 (288)
T ss_dssp             CCTTCEEEEEEEECCCT
T ss_pred             CCCCCEEEEEEECCCCC
T ss_conf             35685589998057776