HHsearch results for GI: 254781095 and protein with PDBid: 2exr_A

>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A*
Probab=99.50  E-value=3.9e-14  Score=108.26  Aligned_cols=184  Identities=12%  Similarity=0.052  Sum_probs=125.7

Q ss_pred             HCCEEEECCC-CCCCCC-CC--CCCEEEEEEEECCHHHHHHHHHHH-HC-CCCEEEECCCCEEEEECCCEECCHHHHCCC
Q ss_conf             0662775488-001522-57--661488999968989999999985-62-998999847520366048840220221123
Q gi|254781095|r   17 LRGKFQENFP-LKQITW-FR--TGGNAEVMFQPQDIHDLKYFLTLL-PS-DIPITIVGLGSNILVRDAGIRGVVLRLSNA   90 (318)
Q Consensus        17 ~~g~i~~n~~-L~~~tt-~r--vGG~A~~~~~p~s~~el~~~l~~~-~~-~~p~~iiG~GSNil~~D~~~~G~vI~l~~~   90 (318)
                      ++|++..+.. +..+++ |.  .-.....++.|+|.+|+++++++| +. ++|+.+.|+|++.--..-+-+|++|.|+++
T Consensus        36 ~~g~~~~~~~~~~~~~~d~~~~~~~~P~~Vv~P~s~~dV~~~v~~a~~~~~~~v~~rggGhs~~g~s~~~~gvvIdl~~m  115 (524)
T 2exr_A           36 IQGEILCGGAAADIAGRDFGGMNCVKPLAVVRPVGPEDIAGAVKAALRSDKLTVAARGNGHSINGQAMAEGGLVVDMSTT  115 (524)
T ss_dssp             CSSEEECSHHHHHHHTCCTTCCCCCCCSEEEECSSHHHHHHHHHHHHHSSSCCEEEESSSCCSSSTTCCTTSEEEEGGGG
T ss_pred             CCCEEECCHHHHHHHCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCEEEEECHHH
T ss_conf             78615128777887503868864127778996799999999999999738915999889938988762898799987243


Q ss_pred             CCCC-----EEEE-CCCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHH-HHHHHHHCCCCC-----CCCCEEEEEEEEE
Q ss_conf             4431-----1330-26651233112215677778875201200038725-663243115732-----1583134566643
Q gi|254781095|r   91 GFSN-----IEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP-GSIGGAAYMNAG-----ANNCETSQYVVEV  158 (318)
Q Consensus        91 ~~~~-----i~~~-~~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIP-GTVGGAi~mNAG-----ayG~ei~d~i~~V  158 (318)
                      +-..     ++++ +...++|+||+.|.++.+.+.++|+.-.--....+ .|+||.+..|+.     .||. +.|+|.++
T Consensus       116 ~~i~~~~~~i~id~~~~~v~V~aGv~~~~l~~~l~~~g~~~~~~~~~~~~~~igg~~~g~g~g~~~~~~G~-~~d~V~~l  194 (524)
T 2exr_A          116 AENHFEVGYLSGGDATAFVDVSGGALWEDVLKRCVSEYGLAPRSWTDYLGLTVGGTLSNAGVSGQAFRYGP-QTSNVTEL  194 (524)
T ss_dssp             TTSCEEEEECCSSSSSEEEEEETTCBHHHHHHHHHHHHSEECSCCCSCCSSBHHHHHTTCCCCTTHHHHCC-GGGSEEEE
T ss_pred             CCCCCCCCCEEECCCCCEEEECCCCCHHHHHHHHHHCCCEEECCCCCCCCCEECCCCCCCCCCCCCCCCCC-HHHEEEEE
T ss_conf             17513456145438998899948828999999999719988068988775125630378988776136476-40104046


Q ss_pred             EEECCCCCEEEECCC---CCCCCCCCCCCCCCCCEEEEECCCCCCCC
Q ss_conf             441123210000123---34431002322467620010023545654
Q gi|254781095|r  159 HGIDRKGNQHVIPRE---QLKYQYRSSEITKDLIITHVVLRGFPESQ  202 (318)
Q Consensus       159 ~~~d~~g~~~~l~~~---e~~f~YR~S~~~~~~iIl~a~l~l~~~~~  202 (318)
                      ++++.+|++.+.+++   |+.+..|.|. ..-.||++++|++.|..+
T Consensus       195 ~vV~~dG~iv~~~~~~~~dL~~a~~Gs~-G~lGIVt~~tlkl~p~p~  240 (524)
T 2exr_A          195 DVVTGNGDVVTCSEIENSELFFSVLGGL-GQFGIITRARVLLQPAPD  240 (524)
T ss_dssp             EEEETTSCEEEEESSSSHHHHHHHTTCT-TSSEEEEEEEEEEEECCS
T ss_pred             EEECCCCCEEEECCCCCHHHHHHHCCCC-CCCEEEEEEEECCCCCCC
T ss_conf             7874897589976854334555421688-862578888760347886