HHsearch results for GI: 254781095 and protein with PDBid: 2gqt_A

>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A*
Probab=100.00  E-value=0  Score=592.15  Aligned_cols=261  Identities=34%  Similarity=0.473  Sum_probs=238.2

Q ss_pred             EECCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHHCCCCEEEECCCCEEEEECCCEECCHHHHCCCCCCCEEEECCC
Q ss_conf             75488001522576614889999689899999999856299899984752036604884022022112344311330266
Q gi|254781095|r   22 QENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHC  101 (318)
Q Consensus        22 ~~n~~L~~~tt~rvGG~A~~~~~p~s~~el~~~l~~~~~~~p~~iiG~GSNil~~D~~~~G~vI~l~~~~~~~i~~~~~~  101 (318)
                      .+|+||++||||||||+|++|+ |++.+||++.     .++|+++||+|||+||+|++|+|+||++.. .+..+    +.
T Consensus         6 ~e~v~Ls~~tt~riGG~a~~~~-~~~~~dl~~~-----~~~p~~vlG~GSNlL~~D~g~~g~vI~l~~-~~~~~----~~   74 (268)
T 2gqt_A            6 VERVLLKDYTTLGVGGPAELWT-VETREELKRA-----TEAPYRVLGNGSNLLVLDEGVPERVIRLAG-EFQTY----DL   74 (268)
T ss_dssp             EEEEEGGGGSSSCCCCEEEEEE-ECSHHHHHHH-----TTSCEEECSSSSSEEECTTCCSSEEEEECG-GGGCB----CT
T ss_pred             HCCCCCCCCCEEEECCEEEEEE-ECCHHHHHHH-----HCCCCEEEECCEEEEEECCCEEEEEEEEEE-ECCCC----CC
T ss_conf             0766567645310383899998-0999999986-----389908992637899968998059999631-02446----54


Q ss_pred             CCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCCCCCCCCCC
Q ss_conf             51233112215677778875201200038725663243115732158313456664344112321000012334431002
Q gi|254781095|r  102 EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS  181 (318)
Q Consensus       102 ~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGayG~ei~d~i~~V~~~d~~g~~~~l~~~e~~f~YR~  181 (318)
                      .++|+||+.|++|+++|+++||+|||||+|||||||||++|||||||.||+|+|++|++++ +|++++++++||+|+||+
T Consensus        75 ~~~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAv~mNaGayG~ei~~~l~sV~v~~-~g~~~~~~~~e~~f~YR~  153 (268)
T 2gqt_A           75 KGWVGAGTLLPLLVQEAARAGLSGLEGLLGIPAQVGGAVKMNAGTRFGEMADALEAVEVFH-DGAFHVYCPEELGFGYRK  153 (268)
T ss_dssp             TSEEETTSBHHHHHHHHHHTTEESCGGGTTCCCBHHHHHHTTCEETTEEGGGGEEEEEEEE-TTEEEEECGGGSCCBTTB
T ss_pred             CEEEECCCCHHHHHHHHHHCCCHHHEEECCCCCCHHHHHHCCCCCCCEEEEEEEEEEEEEC-CCCEEEECHHHCCCCCEE
T ss_conf             3189638548999999998186332242578842455650335777429376999999974-997899736981524011


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCHHHHHHCCCCCCCCCCEEECCC
Q ss_conf             32246762001002354565431001222100110001556670465889727898510002631868820667787156
Q gi|254781095|r  182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL  261 (318)
Q Consensus       182 S~~~~~~iIl~a~l~l~~~~~~~i~~~~~~~~~~R~~~qP~~~~s~GSvFkNP~~~~A~~LIe~~GlKG~~iG~a~vS~k  261 (318)
                      |.|+++++|++|+|++.+++++.+...+....++|  +||...||||||||||++.+||||||+|||||+++|+|+||+|
T Consensus       154 S~~~~~~iil~~~~~l~~~~~~~i~~~~~~~~~~~--~~~~~~~s~GS~FKNP~~~~Ag~LIe~~GlkG~~iG~a~vS~k  231 (268)
T 2gqt_A          154 SHLPPGGIVTRVRLKLKERPKEEILRRMAEVDRAR--KGQPKRKSAGCAFKNPPGQSAGRLIDERGLKGLRVGDAMISLE  231 (268)
T ss_dssp             CCCSTTCEEEEEEECCEECCHHHHHHHHHHHHHHT--TTSCSSCSSSCCBCCCTTCCHHHHHHHTTCTTCEETTEEECSS
T ss_pred             CCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHCCC--CCCCCCCCCCEEEECCCCCCHHHHHHHCCCCCCEECCEEEECC
T ss_conf             45788862378999714698899999999873213--4798878764276588988515557645568965659898145


Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCEEEECC
Q ss_conf             770899689979999999999999999998475400422
Q gi|254781095|r  262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI  300 (318)
Q Consensus       262 HanfivN~g~ata~di~~Li~~v~~~V~~~~gi~Le~Ev  300 (318)
                      |||||||.|+|||+||++||++|    ++++||+||+||
T Consensus       232 HanfivN~g~Ata~Di~~Li~~V----~ek~gi~Le~EV  266 (268)
T 2gqt_A          232 HGNFIVNLGQARAKDVLELVRRV----QEELPLELEWEV  266 (268)
T ss_dssp             CTTCEEECSSCCHHHHHHHHHHH----HHHSCCCBSSEE
T ss_pred             CCCEEEECCCCCHHHHHHHHHHH----HHHHCCEEEEEE
T ss_conf             78789989999999999999999----998696888785